Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 113689..114440 | Replicon | plasmid pSYCC1_tmex_287k |
Accession | NZ_CP113179 | ||
Organism | Klebsiella pneumoniae strain SYCC1 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | OT490_RS26145 | Protein ID | WP_014386536.1 |
Coordinates | 113689..114171 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | OT490_RS26150 | Protein ID | WP_004902250.1 |
Coordinates | 114162..114440 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT490_RS26125 (OT490_26125) | 110088..110735 | - | 648 | WP_014386537.1 | EcsC family protein | - |
OT490_RS26130 (OT490_26130) | 110762..111517 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
OT490_RS26135 (OT490_26135) | 111618..112010 | - | 393 | WP_032442757.1 | hypothetical protein | - |
OT490_RS26140 (OT490_26140) | 112115..112654 | - | 540 | WP_004902239.1 | hypothetical protein | - |
OT490_RS26145 (OT490_26145) | 113689..114171 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
OT490_RS26150 (OT490_26150) | 114162..114440 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
OT490_RS26155 (OT490_26155) | 114559..114771 | - | 213 | WP_004902255.1 | hypothetical protein | - |
OT490_RS26160 (OT490_26160) | 114879..115220 | - | 342 | WP_004902257.1 | hypothetical protein | - |
OT490_RS26165 (OT490_26165) | 116042..116500 | - | 459 | WP_014386535.1 | hypothetical protein | - |
OT490_RS26170 (OT490_26170) | 117754..118638 | + | 885 | WP_004186900.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 / mcr-1.1 | - | 1..287882 | 287882 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T265515 WP_014386536.1 NZ_CP113179:c114171-113689 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |