Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 36214..37124 Replicon plasmid pSYCC1_tmex_287k
Accession NZ_CP113179
Organism Klebsiella pneumoniae strain SYCC1

Toxin (Protein)


Gene name - Uniprot ID A0A5Q9LR54
Locus tag OT490_RS25770 Protein ID WP_004181896.1
Coordinates 36654..37124 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A2J4RLY9
Locus tag OT490_RS25765 Protein ID WP_004181895.1
Coordinates 36214..36657 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT490_RS25740 (OT490_25740) 31369..31584 - 216 Protein_44 IS200/IS605 family transposase -
OT490_RS25745 (OT490_25745) 31586..32155 + 570 Protein_45 transposase -
OT490_RS25750 (OT490_25750) 32847..34334 + 1488 WP_004178082.1 group II intron reverse transcriptase/maturase -
OT490_RS25755 (OT490_25755) 34420..34842 + 423 WP_267721749.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
OT490_RS25760 (OT490_25760) 34842..36113 + 1272 WP_004181894.1 translesion error-prone DNA polymerase V subunit UmuC -
OT490_RS25765 (OT490_25765) 36214..36657 + 444 WP_004181895.1 DUF2384 domain-containing protein Antitoxin
OT490_RS25770 (OT490_25770) 36654..37124 + 471 WP_004181896.1 RES family NAD+ phosphorylase Toxin
OT490_RS25775 (OT490_25775) 37234..37494 - 261 WP_004026352.1 hypothetical protein -
OT490_RS25780 (OT490_25780) 38193..39562 + 1370 WP_085949440.1 IS3-like element ISKpn8 family transposase -
OT490_RS25785 (OT490_25785) 39664..39822 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
OT490_RS25790 (OT490_25790) 40425..41399 + 975 WP_014386572.1 hypothetical protein -
OT490_RS25795 (OT490_25795) 41597..41974 - 378 WP_004181901.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 / mcr-1.1 - 1..287882 287882


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17549.81 Da        Isoelectric Point: 4.6155

>T265514 WP_004181896.1 NZ_CP113179:36654-37124 [Klebsiella pneumoniae]
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16536.87 Da        Isoelectric Point: 10.3013

>AT265514 WP_004181895.1 NZ_CP113179:36214-36657 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LR54

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4RLY9

References