Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4665946..4666781 Replicon chromosome
Accession NZ_CP113178
Organism Klebsiella pneumoniae strain SYCC1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A5E2RWI0
Locus tag OT490_RS22545 Protein ID WP_001559913.1
Coordinates 4665946..4666323 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A5E3EVB5
Locus tag OT490_RS22550 Protein ID WP_032408847.1
Coordinates 4666413..4666781 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT490_RS22505 (4661211) 4661211..4661477 + 267 WP_004178415.1 hypothetical protein -
OT490_RS22510 (4661477) 4661477..4662149 + 673 Protein_4410 DUF4400 domain-containing protein -
OT490_RS22515 (4662160) 4662160..4662876 + 717 WP_223203127.1 RES domain-containing protein -
OT490_RS22520 (4663244) 4663244..4663432 - 189 Protein_4412 transposase -
OT490_RS22525 (4663449) 4663449..4664560 - 1112 Protein_4413 IS3 family transposase -
OT490_RS22530 (4665010) 4665010..4665159 - 150 Protein_4414 restriction endonuclease subunit M -
OT490_RS22535 (4665244) 4665244..4665441 - 198 WP_032408848.1 DUF957 domain-containing protein -
OT490_RS22540 (4665461) 4665461..4665949 - 489 WP_001559914.1 DUF5983 family protein -
OT490_RS22545 (4665946) 4665946..4666323 - 378 WP_001559913.1 TA system toxin CbtA family protein Toxin
OT490_RS22550 (4666413) 4666413..4666781 - 369 WP_032408847.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OT490_RS22555 (4666958) 4666958..4667179 - 222 WP_000692300.1 DUF987 domain-containing protein -
OT490_RS22560 (4667248) 4667248..4667724 - 477 WP_032408846.1 RadC family protein -
OT490_RS22565 (4667739) 4667739..4668224 - 486 WP_032408845.1 antirestriction protein -
OT490_RS22570 (4668316) 4668316..4669134 - 819 WP_001559911.1 DUF932 domain-containing protein -
OT490_RS22575 (4669234) 4669234..4669467 - 234 WP_001119729.1 DUF905 family protein -
OT490_RS22580 (4669546) 4669546..4670001 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4654323..4685803 31480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14148.10 Da        Isoelectric Point: 7.8276

>T265510 WP_001559913.1 NZ_CP113178:c4666323-4665946 [Klebsiella pneumoniae]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13682.62 Da        Isoelectric Point: 7.8398

>AT265510 WP_032408847.1 NZ_CP113178:c4666781-4666413 [Klebsiella pneumoniae]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVMLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5E2RWI0

Antitoxin

Source ID Structure
AlphaFold DB A0A5E3EVB5

References