Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3993036..3993655 Replicon chromosome
Accession NZ_CP113178
Organism Klebsiella pneumoniae strain SYCC1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OT490_RS19345 Protein ID WP_002892050.1
Coordinates 3993437..3993655 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OT490_RS19340 Protein ID WP_002892066.1
Coordinates 3993036..3993410 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT490_RS19330 (3988188) 3988188..3989381 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OT490_RS19335 (3989404) 3989404..3992550 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OT490_RS19340 (3993036) 3993036..3993410 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OT490_RS19345 (3993437) 3993437..3993655 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OT490_RS19350 (3993814) 3993814..3994380 + 567 WP_002892030.1 maltose O-acetyltransferase -
OT490_RS19355 (3994352) 3994352..3994492 - 141 WP_004147370.1 hypothetical protein -
OT490_RS19360 (3994513) 3994513..3994983 + 471 WP_002892026.1 YlaC family protein -
OT490_RS19365 (3994958) 3994958..3996409 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OT490_RS19370 (3996510) 3996510..3997208 + 699 WP_002892021.1 GNAT family protein -
OT490_RS19375 (3997205) 3997205..3997345 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OT490_RS19380 (3997345) 3997345..3997608 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T265508 WP_002892050.1 NZ_CP113178:3993437-3993655 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT265508 WP_002892066.1 NZ_CP113178:3993036-3993410 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References