Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 98494..99146 Replicon plasmid pTSYCC10-2_tmex_229k
Accession NZ_CP113174
Organism Klebsiella pneumoniae strain TSYCC10-2

Toxin (Protein)


Gene name vagD Uniprot ID A0A8A2Q2K1
Locus tag OT486_RS26575 Protein ID WP_017901321.1
Coordinates 98494..98919 (-) Length 142 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A853H7M9
Locus tag OT486_RS26580 Protein ID WP_001261275.1
Coordinates 98916..99146 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT486_RS26540 (OT486_26540) 94203..94319 + 117 Protein_95 transposase -
OT486_RS26545 (OT486_26545) 94444..94614 - 171 Protein_96 LysR family transcriptional regulator -
OT486_RS26550 (OT486_26550) 94625..94852 + 228 Protein_97 IS3 family transposase -
OT486_RS26555 (OT486_26555) 94944..96500 - 1557 WP_025999314.1 sensor domain-containing diguanylate cyclase -
OT486_RS26560 (OT486_26560) 96687..96860 - 174 Protein_99 nuclease -
OT486_RS26565 (OT486_26565) 96913..97449 - 537 Protein_100 integrase core domain-containing protein -
OT486_RS26570 (OT486_26570) 97508..98476 - 969 WP_077254762.1 IS5 family transposase -
OT486_RS26575 (OT486_26575) 98494..98919 - 426 WP_017901321.1 type II toxin-antitoxin system VapC family toxin Toxin
OT486_RS26580 (OT486_26580) 98916..99146 - 231 WP_001261275.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OT486_RS26585 (OT486_26585) 99399..101975 - 2577 WP_017901322.1 nuclease domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 - 1..229076 229076
- flank IS/Tn - - 97508..98476 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15412.91 Da        Isoelectric Point: 7.1364

>T265498 WP_017901321.1 NZ_CP113174:c98919-98494 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE

Download         Length: 426 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8707.72 Da        Isoelectric Point: 4.3410

>AT265498 WP_001261275.1 NZ_CP113174:c99146-98916 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8A2Q2K1

Antitoxin

Source ID Structure
AlphaFold DB A0A853H7M9

References