Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5239944..5240569 | Replicon | chromosome |
Accession | NZ_CP113173 | ||
Organism | Klebsiella pneumoniae strain TSYCC10-2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A483GDF6 |
Locus tag | OT486_RS25700 | Protein ID | WP_004187928.1 |
Coordinates | 5239944..5240327 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | OT486_RS25705 | Protein ID | WP_004150355.1 |
Coordinates | 5240327..5240569 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT486_RS25685 (5237310) | 5237310..5238212 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
OT486_RS25690 (5238209) | 5238209..5238844 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
OT486_RS25695 (5238841) | 5238841..5239770 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
OT486_RS25700 (5239944) | 5239944..5240327 | - | 384 | WP_004187928.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OT486_RS25705 (5240327) | 5240327..5240569 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
OT486_RS25710 (5240763) | 5240763..5241680 | + | 918 | WP_032437488.1 | alpha/beta hydrolase | - |
OT486_RS25715 (5241694) | 5241694..5242635 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
OT486_RS25720 (5242680) | 5242680..5243117 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
OT486_RS25725 (5243114) | 5243114..5243974 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
OT486_RS25730 (5243968) | 5243968..5244567 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14407.64 Da Isoelectric Point: 7.3178
>T265495 WP_004187928.1 NZ_CP113173:c5240327-5239944 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GDF6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |