Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 4665576..4666302 | Replicon | chromosome |
| Accession | NZ_CP113173 | ||
| Organism | Klebsiella pneumoniae strain TSYCC10-2 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | OT486_RS23020 | Protein ID | WP_032437356.1 |
| Coordinates | 4665576..4665917 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | OT486_RS23025 | Protein ID | WP_032437354.1 |
| Coordinates | 4665952..4666302 (-) | Length | 117 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT486_RS22990 (4660583) | 4660583..4661854 | + | 1272 | Protein_4507 | conjugative transfer system coupling protein TraD | - |
| OT486_RS22995 (4661817) | 4661817..4662083 | + | 267 | WP_004178415.1 | hypothetical protein | - |
| OT486_RS23000 (4662083) | 4662083..4662755 | + | 673 | Protein_4509 | DUF4400 domain-containing protein | - |
| OT486_RS23005 (4662766) | 4662766..4663650 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
| OT486_RS23010 (4663849) | 4663849..4664037 | - | 189 | Protein_4511 | transposase | - |
| OT486_RS23015 (4664054) | 4664054..4665165 | - | 1112 | Protein_4512 | IS3 family transposase | - |
| OT486_RS23020 (4665576) | 4665576..4665917 | - | 342 | WP_032437356.1 | TA system toxin CbtA family protein | Toxin |
| OT486_RS23025 (4665952) | 4665952..4666302 | - | 351 | WP_032437354.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OT486_RS23030 (4666323) | 4666323..4666544 | - | 222 | WP_063931680.1 | DUF987 domain-containing protein | - |
| OT486_RS23035 (4666560) | 4666560..4667033 | - | 474 | WP_032437352.1 | DNA repair protein RadC | - |
| OT486_RS23040 (4667104) | 4667104..4667925 | - | 822 | WP_032437350.1 | DUF932 domain-containing protein | - |
| OT486_RS23045 (4668021) | 4668021..4668698 | - | 678 | WP_032437348.1 | hypothetical protein | - |
| OT486_RS23050 (4668984) | 4668984..4669877 | - | 894 | WP_032437346.1 | 50S ribosome-binding GTPase | - |
| OT486_RS23055 (4669975) | 4669975..4671126 | + | 1152 | WP_129075233.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4655928..4693979 | 38051 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12991.04 Da Isoelectric Point: 5.0978
>T265492 WP_032437356.1 NZ_CP113173:c4665917-4665576 [Klebsiella pneumoniae]
MNTLPVINQRAIQLCPSPVTIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIEAGITLVDAVNFLVEKYELVRIDRWAF
GWLEPSPYLRAEDILRMRRDMGLLRGCNHTAAM
MNTLPVINQRAIQLCPSPVTIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIEAGITLVDAVNFLVEKYELVRIDRWAF
GWLEPSPYLRAEDILRMRRDMGLLRGCNHTAAM
Download Length: 342 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 12859.60 Da Isoelectric Point: 6.3108
>AT265492 WP_032437354.1 NZ_CP113173:c4666302-4665952 [Klebsiella pneumoniae]
MSNKTQTVNGDTAEPRWGLSCNVIPCFGARLVQEGNRLHYLADRASITGQFNEADLIHPDQAFPVLLKQAELMLTSGELN
PRHQHCVTFCEKGLTCEADTLGSCGHVYIVIYPTQR
MSNKTQTVNGDTAEPRWGLSCNVIPCFGARLVQEGNRLHYLADRASITGQFNEADLIHPDQAFPVLLKQAELMLTSGELN
PRHQHCVTFCEKGLTCEADTLGSCGHVYIVIYPTQR
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|