Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 36216..37126 Replicon plasmid pTSNTC34-1_tmex_296k
Accession NZ_CP113169
Organism Klebsiella pneumoniae strain TSNTC34-1

Toxin (Protein)


Gene name - Uniprot ID A0A5Q9LR54
Locus tag OT488_RS25740 Protein ID WP_004181896.1
Coordinates 36656..37126 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A2J4RLY9
Locus tag OT488_RS25735 Protein ID WP_004181895.1
Coordinates 36216..36659 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT488_RS25710 (OT488_25710) 31371..31586 - 216 Protein_43 IS200/IS605 family transposase -
OT488_RS25715 (OT488_25715) 31588..32157 + 570 Protein_44 transposase -
OT488_RS25720 (OT488_25720) 32849..34336 + 1488 WP_004178082.1 group II intron reverse transcriptase/maturase -
OT488_RS25725 (OT488_25725) 34422..34844 + 423 WP_004181893.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
OT488_RS25730 (OT488_25730) 34844..36115 + 1272 WP_004181894.1 translesion error-prone DNA polymerase V subunit UmuC -
OT488_RS25735 (OT488_25735) 36216..36659 + 444 WP_004181895.1 DUF2384 domain-containing protein Antitoxin
OT488_RS25740 (OT488_25740) 36656..37126 + 471 WP_004181896.1 RES family NAD+ phosphorylase Toxin
OT488_RS25745 (OT488_25745) 37236..37496 - 261 WP_004026352.1 hypothetical protein -
OT488_RS25750 (OT488_25750) 38219..38377 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
OT488_RS25755 (OT488_25755) 38980..39954 + 975 WP_040222313.1 hypothetical protein -
OT488_RS25760 (OT488_25760) 40152..40529 - 378 WP_004181901.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / floR / tet(A) / mph(A) / qnrB91 / blaDHA-1 / qnrB4 - 1..296308 296308
- flank IS/Tn - - 31771..32157 386


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17549.81 Da        Isoelectric Point: 4.6155

>T265479 WP_004181896.1 NZ_CP113169:36656-37126 [Klebsiella pneumoniae]
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16536.87 Da        Isoelectric Point: 10.3013

>AT265479 WP_004181895.1 NZ_CP113169:36216-36659 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LR54

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4RLY9

References