Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4678497..4679013 | Replicon | chromosome |
Accession | NZ_CP113168 | ||
Organism | Klebsiella pneumoniae strain TSNTC34-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | OT488_RS22740 | Protein ID | WP_009486548.1 |
Coordinates | 4678497..4678781 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OT488_RS22745 | Protein ID | WP_002886901.1 |
Coordinates | 4678771..4679013 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT488_RS22715 (4673914) | 4673914..4674177 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
OT488_RS22720 (4674307) | 4674307..4674480 | + | 174 | WP_032433782.1 | hypothetical protein | - |
OT488_RS22725 (4674483) | 4674483..4675226 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OT488_RS22730 (4675583) | 4675583..4677721 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OT488_RS22735 (4678029) | 4678029..4678493 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OT488_RS22740 (4678497) | 4678497..4678781 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OT488_RS22745 (4678771) | 4678771..4679013 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OT488_RS22750 (4679091) | 4679091..4681001 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
OT488_RS22755 (4681024) | 4681024..4682178 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
OT488_RS22760 (4682245) | 4682245..4682985 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T265476 WP_009486548.1 NZ_CP113168:c4678781-4678497 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |