Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 9422..9947 | Replicon | plasmid pTSNTC10-1_mcr-8_104 |
Accession | NZ_CP113167 | ||
Organism | Klebsiella pneumoniae strain TSNTC10-1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | D4HQE7 |
Locus tag | OT484_RS28045 | Protein ID | WP_013023785.1 |
Coordinates | 9642..9947 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A1D8K3R4 |
Locus tag | OT484_RS28040 | Protein ID | WP_006788213.1 |
Coordinates | 9422..9640 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT484_RS28020 (OT484_28020) | 4669..5637 | + | 969 | WP_075211999.1 | IS5 family transposase | - |
OT484_RS28025 (OT484_28025) | 6109..6900 | - | 792 | WP_221928726.1 | ribbon-helix-helix domain-containing protein | - |
OT484_RS28030 (OT484_28030) | 7083..8111 | - | 1029 | WP_032445668.1 | Abi family protein | - |
OT484_RS28035 (OT484_28035) | 8272..8853 | - | 582 | WP_072310991.1 | hypothetical protein | - |
OT484_RS28040 (OT484_28040) | 9422..9640 | + | 219 | WP_006788213.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
OT484_RS28045 (OT484_28045) | 9642..9947 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
OT484_RS28050 (OT484_28050) | 10116..10511 | + | 396 | WP_017899885.1 | hypothetical protein | - |
OT484_RS28055 (OT484_28055) | 10538..10861 | + | 324 | WP_004197641.1 | hypothetical protein | - |
OT484_RS28060 (OT484_28060) | 10858..11874 | + | 1017 | WP_118842534.1 | hypothetical protein | - |
OT484_RS28065 (OT484_28065) | 12072..12857 | + | 786 | WP_046664219.1 | site-specific integrase | - |
OT484_RS28070 (OT484_28070) | 13306..14061 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-15 | - | 1..104215 | 104215 | |
- | flank | IS/Tn | - | - | 4669..5637 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T265463 WP_013023785.1 NZ_CP113167:9642-9947 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D8K3R4 |