Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 129050..129702 Replicon plasmid pTSNTC10-1_tmex_202k
Accession NZ_CP113166
Organism Klebsiella pneumoniae strain TSNTC10-1

Toxin (Protein)


Gene name vagD Uniprot ID A0A8A2Q2K1
Locus tag OT484_RS27610 Protein ID WP_017901321.1
Coordinates 129050..129475 (-) Length 142 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A853H7M9
Locus tag OT484_RS27615 Protein ID WP_001261275.1
Coordinates 129472..129702 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT484_RS27575 (OT484_27575) 124759..124875 + 117 Protein_130 transposase -
OT484_RS27580 (OT484_27580) 125000..125170 - 171 Protein_131 LysR family transcriptional regulator -
OT484_RS27585 (OT484_27585) 125181..125408 + 228 Protein_132 IS3 family transposase -
OT484_RS27590 (OT484_27590) 125500..127056 - 1557 WP_025999314.1 sensor domain-containing diguanylate cyclase -
OT484_RS27595 (OT484_27595) 127243..127416 - 174 Protein_134 nuclease -
OT484_RS27600 (OT484_27600) 127469..128005 - 537 Protein_135 integrase core domain-containing protein -
OT484_RS27605 (OT484_27605) 128064..129032 - 969 WP_077254762.1 IS5 family transposase -
OT484_RS27610 (OT484_27610) 129050..129475 - 426 WP_017901321.1 type II toxin-antitoxin system VapC family toxin Toxin
OT484_RS27615 (OT484_27615) 129472..129702 - 231 WP_001261275.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OT484_RS27620 (OT484_27620) 129955..132531 - 2577 WP_017901322.1 nuclease domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / blaDHA-1 / qnrB4 / tet(A) / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / aac(3)-IId / mph(A) / qnrB91 - 1..202189 202189
- flank IS/Tn - - 128064..129032 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15412.91 Da        Isoelectric Point: 7.1364

>T265462 WP_017901321.1 NZ_CP113166:c129475-129050 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE

Download         Length: 426 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8707.72 Da        Isoelectric Point: 4.3410

>AT265462 WP_001261275.1 NZ_CP113166:c129702-129472 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8A2Q2K1

Antitoxin

Source ID Structure
AlphaFold DB A0A853H7M9

References