Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 65446..66356 Replicon plasmid pTSNTC10-1_tmex_202k
Accession NZ_CP113166
Organism Klebsiella pneumoniae strain TSNTC10-1

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag OT484_RS27275 Protein ID WP_032413375.1
Coordinates 65886..66356 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A7H4PRG4
Locus tag OT484_RS27270 Protein ID WP_032413443.1
Coordinates 65446..65889 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT484_RS27240 (OT484_27240) 61130..61801 - 672 WP_159226239.1 alpha/beta hydrolase -
OT484_RS27245 (OT484_27245) 61892..62860 - 969 WP_077268726.1 IS5-like element IS903B family transposase -
OT484_RS27250 (OT484_27250) 63276..63824 + 549 WP_023320124.1 GNAT family N-acetyltransferase -
OT484_RS27255 (OT484_27255) 63947..64528 - 582 WP_077254766.1 transposase -
OT484_RS27260 (OT484_27260) 64548..64733 + 186 WP_071571073.1 DUF2188 domain-containing protein -
OT484_RS27265 (OT484_27265) 64834..65346 + 513 Protein_68 DUF4113 domain-containing protein -
OT484_RS27270 (OT484_27270) 65446..65889 + 444 WP_032413443.1 DUF2384 domain-containing protein Antitoxin
OT484_RS27275 (OT484_27275) 65886..66356 + 471 WP_032413375.1 RES family NAD+ phosphorylase Toxin
OT484_RS27280 (OT484_27280) 66466..66726 - 261 WP_017901409.1 hypothetical protein -
OT484_RS27285 (OT484_27285) 67426..68795 + 1370 WP_267695986.1 IS3-like element ISKpn8 family transposase -
OT484_RS27290 (OT484_27290) 68814..69122 - 309 Protein_73 integrase core domain-containing protein -
OT484_RS27295 (OT484_27295) 69196..69389 + 194 Protein_74 transposase -
OT484_RS27300 (OT484_27300) 69512..70462 + 951 WP_077268727.1 IS5-like element IS903B family transposase -
OT484_RS27305 (OT484_27305) 70473..71000 + 528 WP_224707344.1 hypothetical protein -
OT484_RS27310 (OT484_27310) 70941..71096 - 156 Protein_77 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / blaDHA-1 / qnrB4 / tet(A) / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / aac(3)-IId / mph(A) / qnrB91 - 1..202189 202189
- inside IScluster/Tn - - 57835..74981 17146


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre

(16-147)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17547.79 Da        Isoelectric Point: 4.5152

>T265460 WP_032413375.1 NZ_CP113166:65886-66356 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIAFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16508.82 Da        Isoelectric Point: 10.3013

>AT265460 WP_032413443.1 NZ_CP113166:65446-65889 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7H4PRG4

References