Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 5162777..5163293 | Replicon | chromosome |
Accession | NZ_CP113165 | ||
Organism | Klebsiella pneumoniae strain TSNTC10-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | OT484_RS25640 | Protein ID | WP_002886902.1 |
Coordinates | 5162777..5163061 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OT484_RS25645 | Protein ID | WP_002886901.1 |
Coordinates | 5163051..5163293 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT484_RS25615 (OT484_25615) | 5158261..5158569 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
OT484_RS25620 (OT484_25620) | 5158654..5158827 | + | 174 | WP_002886906.1 | hypothetical protein | - |
OT484_RS25625 (OT484_25625) | 5158830..5159573 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OT484_RS25630 (OT484_25630) | 5159930..5162068 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OT484_RS25635 (OT484_25635) | 5162309..5162773 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OT484_RS25640 (OT484_25640) | 5162777..5163061 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OT484_RS25645 (OT484_25645) | 5163051..5163293 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OT484_RS25650 (OT484_25650) | 5163371..5165281 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
OT484_RS25655 (OT484_25655) | 5165304..5166458 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
OT484_RS25660 (OT484_25660) | 5166524..5167264 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T265458 WP_002886902.1 NZ_CP113165:c5163061-5162777 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |