Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4407990..4408609 Replicon chromosome
Accession NZ_CP113165
Organism Klebsiella pneumoniae strain TSNTC10-1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OT484_RS21925 Protein ID WP_002892050.1
Coordinates 4408391..4408609 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OT484_RS21920 Protein ID WP_002892066.1
Coordinates 4407990..4408364 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT484_RS21910 (OT484_21910) 4403142..4404335 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OT484_RS21915 (OT484_21915) 4404358..4407504 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OT484_RS21920 (OT484_21920) 4407990..4408364 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OT484_RS21925 (OT484_21925) 4408391..4408609 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OT484_RS21930 (OT484_21930) 4408768..4409334 + 567 WP_002892030.1 maltose O-acetyltransferase -
OT484_RS21935 (OT484_21935) 4409306..4409446 - 141 WP_004147370.1 hypothetical protein -
OT484_RS21940 (OT484_21940) 4409467..4409937 + 471 WP_002892026.1 YlaC family protein -
OT484_RS21945 (OT484_21945) 4409912..4411363 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OT484_RS21950 (OT484_21950) 4411464..4412162 + 699 WP_002892021.1 GNAT family protein -
OT484_RS21955 (OT484_21955) 4412159..4412299 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OT484_RS21960 (OT484_21960) 4412299..4412562 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T265456 WP_002892050.1 NZ_CP113165:4408391-4408609 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT265456 WP_002892066.1 NZ_CP113165:4407990-4408364 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References