Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1819493..1820229 | Replicon | chromosome |
| Accession | NZ_CP113165 | ||
| Organism | Klebsiella pneumoniae strain TSNTC10-1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | OT484_RS09030 | Protein ID | WP_032433360.1 |
| Coordinates | 1819747..1820229 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | OT484_RS09025 | Protein ID | WP_003026799.1 |
| Coordinates | 1819493..1819759 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT484_RS09000 (OT484_09000) | 1815139..1816278 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
| OT484_RS09005 (OT484_09005) | 1816307..1816969 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| OT484_RS09010 (OT484_09010) | 1816953..1817957 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
| OT484_RS09015 (OT484_09015) | 1817975..1818607 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| OT484_RS09020 (OT484_09020) | 1818617..1819180 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| OT484_RS09025 (OT484_09025) | 1819493..1819759 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| OT484_RS09030 (OT484_09030) | 1819747..1820229 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| OT484_RS09035 (OT484_09035) | 1821402..1822346 | - | 945 | WP_077254249.1 | fimbrial protein | - |
| OT484_RS09040 (OT484_09040) | 1822358..1822936 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
| OT484_RS09045 (OT484_09045) | 1822940..1823680 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1788356..1831172 | 42816 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T265450 WP_032433360.1 NZ_CP113165:1819747-1820229 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |