Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1802802..1803445 | Replicon | chromosome |
| Accession | NZ_CP113165 | ||
| Organism | Klebsiella pneumoniae strain TSNTC10-1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | OT484_RS08935 | Protein ID | WP_032433387.1 |
| Coordinates | 1803029..1803445 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | OT484_RS08930 | Protein ID | WP_001261276.1 |
| Coordinates | 1802802..1803032 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT484_RS08915 (OT484_08915) | 1797824..1798911 | + | 1088 | Protein_1720 | transcriptional regulator | - |
| OT484_RS08920 (OT484_08920) | 1798914..1801154 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| OT484_RS08925 (OT484_08925) | 1801682..1802497 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| OT484_RS08930 (OT484_08930) | 1802802..1803032 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OT484_RS08935 (OT484_08935) | 1803029..1803445 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OT484_RS08940 (OT484_08940) | 1803601..1804581 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| OT484_RS08945 (OT484_08945) | 1804776..1806347 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| OT484_RS08950 (OT484_08950) | 1806666..1806914 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| OT484_RS08955 (OT484_08955) | 1806973..1807491 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| OT484_RS08960 (OT484_08960) | 1807522..1808013 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| OT484_RS08965 (OT484_08965) | 1808073..1808276 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1788356..1831172 | 42816 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T265449 WP_032433387.1 NZ_CP113165:1803029-1803445 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |