Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4559569..4560223 | Replicon | chromosome |
Accession | NZ_CP113163 | ||
Organism | Citrobacter braakii strain LBA3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | MKJ05_RS21780 | Protein ID | WP_114681070.1 |
Coordinates | 4559816..4560223 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | MKJ05_RS21775 | Protein ID | WP_016154349.1 |
Coordinates | 4559569..4559835 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKJ05_RS21750 (MKJ05_21750) | 4554782..4556215 | - | 1434 | WP_267588330.1 | 6-phospho-beta-glucosidase BglA | - |
MKJ05_RS21755 (MKJ05_21755) | 4556336..4557064 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
MKJ05_RS21760 (MKJ05_21760) | 4557117..4557428 | + | 312 | WP_114681074.1 | N(4)-acetylcytidine aminohydrolase | - |
MKJ05_RS21765 (MKJ05_21765) | 4557592..4558251 | + | 660 | WP_114681073.1 | hemolysin III family protein | - |
MKJ05_RS21770 (MKJ05_21770) | 4558331..4559311 | - | 981 | WP_267588331.1 | tRNA-modifying protein YgfZ | - |
MKJ05_RS21775 (MKJ05_21775) | 4559569..4559835 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
MKJ05_RS21780 (MKJ05_21780) | 4559816..4560223 | + | 408 | WP_114681070.1 | protein YgfX | Toxin |
MKJ05_RS21785 (MKJ05_21785) | 4560324..4560845 | - | 522 | WP_199143062.1 | flavodoxin FldB | - |
MKJ05_RS21790 (MKJ05_21790) | 4560958..4561854 | + | 897 | WP_103766659.1 | site-specific tyrosine recombinase XerD | - |
MKJ05_RS21795 (MKJ05_21795) | 4561878..4562591 | + | 714 | WP_114681068.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
MKJ05_RS21800 (MKJ05_21800) | 4562597..4564330 | + | 1734 | WP_267588332.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15924.80 Da Isoelectric Point: 11.2845
>T265443 WP_114681070.1 NZ_CP113163:4559816-4560223 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLMLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDVGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLMLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDVGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|