Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3419205..3419821 | Replicon | chromosome |
Accession | NZ_CP113163 | ||
Organism | Citrobacter braakii strain LBA3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MKJ05_RS16295 | Protein ID | WP_016155182.1 |
Coordinates | 3419205..3419579 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MKJ05_RS16300 | Protein ID | WP_181818053.1 |
Coordinates | 3419579..3419821 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKJ05_RS16280 (MKJ05_16280) | 3416708..3417610 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
MKJ05_RS16285 (MKJ05_16285) | 3417607..3418242 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
MKJ05_RS16290 (MKJ05_16290) | 3418239..3419168 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
MKJ05_RS16295 (MKJ05_16295) | 3419205..3419579 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MKJ05_RS16300 (MKJ05_16300) | 3419579..3419821 | - | 243 | WP_181818053.1 | CopG family transcriptional regulator | Antitoxin |
MKJ05_RS16305 (MKJ05_16305) | 3420027..3420956 | + | 930 | WP_267583561.1 | alpha/beta hydrolase | - |
MKJ05_RS16310 (MKJ05_16310) | 3421041..3421352 | + | 312 | WP_114683723.1 | type II toxin-antitoxin system HigB family toxin | - |
MKJ05_RS16315 (MKJ05_16315) | 3421349..3421801 | + | 453 | WP_114683722.1 | helix-turn-helix domain-containing protein | - |
MKJ05_RS16320 (MKJ05_16320) | 3421819..3422760 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
MKJ05_RS16325 (MKJ05_16325) | 3422805..3423242 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
MKJ05_RS16330 (MKJ05_16330) | 3423239..3424111 | - | 873 | WP_114683721.1 | virulence factor BrkB family protein | - |
MKJ05_RS16335 (MKJ05_16335) | 3424105..3424704 | - | 600 | WP_114683720.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13678.84 Da Isoelectric Point: 8.5373
>T265440 WP_016155182.1 NZ_CP113163:c3419579-3419205 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|