Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 2939508..2940234 | Replicon | chromosome |
Accession | NZ_CP113163 | ||
Organism | Citrobacter braakii strain LBA3 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | MKJ05_RS14060 | Protein ID | WP_134882353.1 |
Coordinates | 2939508..2939849 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | MKJ05_RS14065 | Protein ID | WP_004129347.1 |
Coordinates | 2939884..2940234 (-) | Length | 117 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKJ05_RS14040 (MKJ05_14040) | 2934737..2936575 | + | 1839 | WP_267581382.1 | pilus assembly protein | - |
MKJ05_RS14045 (MKJ05_14045) | 2936638..2937456 | + | 819 | WP_181013961.1 | CZB domain-containing protein | - |
MKJ05_RS14050 (MKJ05_14050) | 2937653..2938351 | + | 699 | WP_114683307.1 | CZB domain-containing protein | - |
MKJ05_RS14055 (MKJ05_14055) | 2938522..2938992 | + | 471 | WP_151235961.1 | transglycosylase SLT domain-containing protein | - |
MKJ05_RS14060 (MKJ05_14060) | 2939508..2939849 | - | 342 | WP_134882353.1 | TA system toxin CbtA family protein | Toxin |
MKJ05_RS14065 (MKJ05_14065) | 2939884..2940234 | - | 351 | WP_004129347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
MKJ05_RS14070 (MKJ05_14070) | 2940255..2940476 | - | 222 | WP_004129348.1 | DUF987 domain-containing protein | - |
MKJ05_RS14075 (MKJ05_14075) | 2940492..2940965 | - | 474 | WP_107357770.1 | DNA repair protein RadC | - |
MKJ05_RS14080 (MKJ05_14080) | 2941036..2941857 | - | 822 | WP_267589304.1 | DUF932 domain-containing protein | - |
MKJ05_RS14085 (MKJ05_14085) | 2941953..2942630 | - | 678 | WP_134882355.1 | hypothetical protein | - |
MKJ05_RS14090 (MKJ05_14090) | 2942915..2943808 | - | 894 | WP_107357772.1 | 50S ribosome-binding GTPase | - |
MKJ05_RS14095 (MKJ05_14095) | 2943907..2945004 | - | 1098 | WP_117031494.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2918729..2955299 | 36570 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12947.97 Da Isoelectric Point: 5.5865
>T265439 WP_134882353.1 NZ_CP113163:c2939849-2939508 [Citrobacter braakii]
MNTLPAINQWAVQLCPSPVNIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIDAGITLVDTVNFLVEKYELVRIDRRAF
GWLEPSPYLRAVDILRMRRDMGLLRGCNHTAAM
MNTLPAINQWAVQLCPSPVNIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIDAGITLVDTVNFLVEKYELVRIDRRAF
GWLEPSPYLRAVDILRMRRDMGLLRGCNHTAAM
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|