Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2318955..2319575 | Replicon | chromosome |
Accession | NZ_CP113163 | ||
Organism | Citrobacter braakii strain LBA3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | MKJ05_RS11135 | Protein ID | WP_002892050.1 |
Coordinates | 2319357..2319575 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | MKJ05_RS11130 | Protein ID | WP_003021733.1 |
Coordinates | 2318955..2319329 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKJ05_RS11120 (MKJ05_11120) | 2314102..2315295 | + | 1194 | WP_114682035.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
MKJ05_RS11125 (MKJ05_11125) | 2315318..2318467 | + | 3150 | WP_114682034.1 | efflux RND transporter permease AcrB | - |
MKJ05_RS11130 (MKJ05_11130) | 2318955..2319329 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
MKJ05_RS11135 (MKJ05_11135) | 2319357..2319575 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
MKJ05_RS11140 (MKJ05_11140) | 2319756..2320307 | + | 552 | WP_200110267.1 | maltose O-acetyltransferase | - |
MKJ05_RS11145 (MKJ05_11145) | 2320424..2320894 | + | 471 | WP_114682032.1 | YlaC family protein | - |
MKJ05_RS11150 (MKJ05_11150) | 2320972..2321112 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
MKJ05_RS11155 (MKJ05_11155) | 2321114..2321374 | - | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
MKJ05_RS11160 (MKJ05_11160) | 2321563..2323116 | + | 1554 | WP_267589220.1 | EAL domain-containing protein | - |
MKJ05_RS11165 (MKJ05_11165) | 2323168..2323521 | - | 354 | WP_114682030.1 | DUF1428 family protein | - |
MKJ05_RS11170 (MKJ05_11170) | 2323586..2324215 | - | 630 | WP_200110266.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T265438 WP_002892050.1 NZ_CP113163:2319357-2319575 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT265438 WP_003021733.1 NZ_CP113163:2318955-2319329 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |