Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1653269..1653859 | Replicon | chromosome |
| Accession | NZ_CP113163 | ||
| Organism | Citrobacter braakii strain LBA3 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | MKJ05_RS07995 | Protein ID | WP_267589032.1 |
| Coordinates | 1653269..1653601 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | MKJ05_RS08000 | Protein ID | WP_267589033.1 |
| Coordinates | 1653602..1653859 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKJ05_RS07955 (MKJ05_07955) | 1649416..1649873 | + | 458 | Protein_1563 | hypothetical protein | - |
| MKJ05_RS07960 (MKJ05_07960) | 1649853..1649999 | + | 147 | WP_267589294.1 | AlpA family phage regulatory protein | - |
| MKJ05_RS07965 (MKJ05_07965) | 1650021..1650202 | + | 182 | Protein_1565 | hypothetical protein | - |
| MKJ05_RS07970 (MKJ05_07970) | 1650187..1650500 | + | 314 | Protein_1566 | STY4526/YPO1902 family pathogenicity island replication protein | - |
| MKJ05_RS07975 (MKJ05_07975) | 1650490..1650702 | + | 213 | WP_114682487.1 | TraR/DksA family transcriptional regulator | - |
| MKJ05_RS07980 (MKJ05_07980) | 1650825..1651775 | - | 951 | WP_016152661.1 | HTH-type transcriptional regulator Cbl | - |
| MKJ05_RS07985 (MKJ05_07985) | 1651877..1652794 | - | 918 | WP_267589031.1 | nitrogen assimilation transcriptional regulator NAC | - |
| MKJ05_RS07995 (MKJ05_07995) | 1653269..1653601 | - | 333 | WP_267589032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| MKJ05_RS08000 (MKJ05_08000) | 1653602..1653859 | - | 258 | WP_267589033.1 | antitoxin | Antitoxin |
| MKJ05_RS08005 (MKJ05_08005) | 1654471..1655556 | + | 1086 | WP_267589034.1 | hypothetical protein | - |
| MKJ05_RS08010 (MKJ05_08010) | 1655667..1658369 | + | 2703 | WP_267589035.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1649703..1664763 | 15060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11800.58 Da Isoelectric Point: 10.2965
>T265437 WP_267589032.1 NZ_CP113163:c1653601-1653269 [Citrobacter braakii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPITSGGNFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPITSGGNFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|