Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
| Location | 17972..18573 | Replicon | plasmid pBRV276 |
| Accession | NZ_CP113118 | ||
| Organism | Levilactobacillus brevis strain SMB091 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | Q684P1 |
| Locus tag | ORR04_RS12250 | Protein ID | WP_001748110.1 |
| Coordinates | 17972..18316 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | Q684P2 |
| Locus tag | ORR04_RS12255 | Protein ID | WP_003643337.1 |
| Coordinates | 18310..18573 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORR04_RS12230 (ORR04_12230) | 13881..15035 | + | 1155 | WP_267668706.1 | cation:proton antiporter | - |
| ORR04_RS12235 (ORR04_12235) | 15158..16726 | + | 1569 | WP_267668708.1 | ClC family H(+)/Cl(-) exchange transporter | - |
| ORR04_RS12240 (ORR04_12240) | 16832..16921 | + | 90 | Protein_16 | IS30 family transposase | - |
| ORR04_RS12245 (ORR04_12245) | 16963..17430 | - | 468 | WP_233758948.1 | DNA starvation/stationary phase protection protein | - |
| ORR04_RS12250 (ORR04_12250) | 17972..18316 | - | 345 | WP_001748110.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| ORR04_RS12255 (ORR04_12255) | 18310..18573 | - | 264 | WP_003643337.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| ORR04_RS12260 (ORR04_12260) | 18512..18814 | + | 303 | Protein_20 | site-specific integrase | - |
| ORR04_RS12270 (ORR04_12270) | 19652..20104 | + | 453 | WP_267668727.1 | tyrosine-type recombinase/integrase | - |
| ORR04_RS12275 (ORR04_12275) | 20595..21434 | + | 840 | Protein_23 | IS30 family transposase | - |
| ORR04_RS12280 (ORR04_12280) | 21431..21634 | - | 204 | WP_267668715.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..27635 | 27635 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13041.89 Da Isoelectric Point: 6.4782
>T265431 WP_001748110.1 NZ_CP113118:c18316-17972 [Levilactobacillus brevis]
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0R2K1X3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6L4ZZT2 |