Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
| Location | 1009424..1010090 | Replicon | chromosome |
| Accession | NZ_CP113116 | ||
| Organism | Mycobacterium sp. Aquia_213 | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | - |
| Locus tag | LMQ14_RS04950 | Protein ID | WP_267733703.1 |
| Coordinates | 1009617..1010090 (+) | Length | 158 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | - |
| Locus tag | LMQ14_RS04945 | Protein ID | WP_085221917.1 |
| Coordinates | 1009424..1009612 (+) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LMQ14_RS04930 (LMQ14_04930) | 1004760..1005299 | - | 540 | WP_267733700.1 | G/U mismatch-specific DNA glycosylase | - |
| LMQ14_RS04935 (LMQ14_04935) | 1005344..1006924 | + | 1581 | WP_267733701.1 | serine hydrolase | - |
| LMQ14_RS04940 (LMQ14_04940) | 1006921..1009320 | + | 2400 | WP_267733702.1 | cation-translocating P-type ATPase | - |
| LMQ14_RS04945 (LMQ14_04945) | 1009424..1009612 | + | 189 | WP_085221917.1 | antitoxin | Antitoxin |
| LMQ14_RS04950 (LMQ14_04950) | 1009617..1010090 | + | 474 | WP_267733703.1 | SRPBCC family protein | Toxin |
| LMQ14_RS04955 (LMQ14_04955) | 1010074..1011315 | + | 1242 | WP_267733704.1 | cyclopropane-fatty-acyl-phospholipid synthase family protein | - |
| LMQ14_RS04960 (LMQ14_04960) | 1011387..1012160 | + | 774 | WP_267733705.1 | VOC family protein | - |
| LMQ14_RS04965 (LMQ14_04965) | 1012236..1012670 | + | 435 | WP_267733706.1 | hypothetical protein | - |
| LMQ14_RS04970 (LMQ14_04970) | 1012674..1013159 | - | 486 | WP_267733707.1 | VOC family protein | - |
| LMQ14_RS04975 (LMQ14_04975) | 1013197..1014711 | - | 1515 | WP_267733708.1 | carotenoid oxygenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 17103.80 Da Isoelectric Point: 10.3744
>T265429 WP_267733703.1 NZ_CP113116:1009617-1010090 [Mycobacterium sp. Aquia_213]
MAKLSGSIDVPLSPERAWTHASDLSRFKDWLSIHRVWRSKLPDDLQKGTVIESIVEVKGMLNRIKWTIVHYKPPEAMTLN
GDGVGGVKVKLIAKVKPKDDGSVVSFDVHLGGPALFGPIGMIVAAALRSDINESLERFVTVFTAPDPGRNGHGGARR
MAKLSGSIDVPLSPERAWTHASDLSRFKDWLSIHRVWRSKLPDDLQKGTVIESIVEVKGMLNRIKWTIVHYKPPEAMTLN
GDGVGGVKVKLIAKVKPKDDGSVVSFDVHLGGPALFGPIGMIVAAALRSDINESLERFVTVFTAPDPGRNGHGGARR
Download Length: 474 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|