Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 964287..964955 | Replicon | chromosome |
Accession | NZ_CP113115 | ||
Organism | Streptococcus pneumoniae strain NP2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | C1C927 |
Locus tag | OTU47_RS05235 | Protein ID | WP_001132282.1 |
Coordinates | 964287..964466 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | OTU47_RS05240 | Protein ID | WP_000961810.1 |
Coordinates | 964503..964955 (+) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OTU47_RS05205 (OTU47_05205) | 959305..960150 | + | 846 | WP_000819520.1 | carbohydrate ABC transporter permease | - |
OTU47_RS05210 (OTU47_05210) | 960160..961479 | + | 1320 | WP_000608880.1 | glycoside hydrolase family 32 protein | - |
OTU47_RS05220 (OTU47_05220) | 962026..963297 | - | 1272 | WP_001113215.1 | replication-associated recombination protein A | - |
OTU47_RS05225 (OTU47_05225) | 963567..963806 | + | 240 | WP_000818078.1 | hypothetical protein | - |
OTU47_RS05230 (OTU47_05230) | 963971..964150 | + | 180 | WP_001048906.1 | hypothetical protein | - |
OTU47_RS05235 (OTU47_05235) | 964287..964466 | + | 180 | WP_001132282.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OTU47_RS05240 (OTU47_05240) | 964503..964955 | + | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OTU47_RS05245 (OTU47_05245) | 965246..965716 | + | 471 | WP_000257094.1 | DUF3013 family protein | - |
OTU47_RS05250 (OTU47_05250) | 965735..966823 | + | 1089 | WP_000719700.1 | site-2 protease family protein | - |
OTU47_RS05255 (OTU47_05255) | 966804..967232 | + | 429 | WP_000418161.1 | NUDIX hydrolase | - |
OTU47_RS05260 (OTU47_05260) | 967367..968320 | + | 954 | WP_000970769.1 | 50S ribosomal protein L11 methyltransferase | - |
OTU47_RS05265 (OTU47_05265) | 968322..969065 | + | 744 | WP_001188201.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.95 Da Isoelectric Point: 11.0174
>T265427 WP_001132282.1 NZ_CP113115:964287-964466 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERLITIPHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERLITIPHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT265427 WP_000961810.1 NZ_CP113115:964503-964955 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E7SUI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5YRZ | |
AlphaFold DB | G0IC64 |