Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1840626..1841294 | Replicon | chromosome |
Accession | NZ_CP113114 | ||
Organism | Streptococcus pneumoniae strain NP1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | C1C927 |
Locus tag | OTU45_RS09330 | Protein ID | WP_001132282.1 |
Coordinates | 1841115..1841294 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | OTU45_RS09325 | Protein ID | WP_000961810.1 |
Coordinates | 1840626..1841078 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OTU45_RS09300 (OTU45_09300) | 1836516..1837259 | - | 744 | WP_001188201.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
OTU45_RS09305 (OTU45_09305) | 1837261..1838214 | - | 954 | WP_000970769.1 | 50S ribosomal protein L11 methyltransferase | - |
OTU45_RS09310 (OTU45_09310) | 1838349..1838777 | - | 429 | WP_000418161.1 | NUDIX hydrolase | - |
OTU45_RS09315 (OTU45_09315) | 1838758..1839846 | - | 1089 | WP_000719700.1 | site-2 protease family protein | - |
OTU45_RS09320 (OTU45_09320) | 1839865..1840335 | - | 471 | WP_000257094.1 | DUF3013 family protein | - |
OTU45_RS09325 (OTU45_09325) | 1840626..1841078 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OTU45_RS09330 (OTU45_09330) | 1841115..1841294 | - | 180 | WP_001132282.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OTU45_RS09335 (OTU45_09335) | 1841431..1841610 | - | 180 | WP_001048906.1 | hypothetical protein | - |
OTU45_RS09340 (OTU45_09340) | 1841775..1842014 | - | 240 | WP_000818078.1 | hypothetical protein | - |
OTU45_RS09345 (OTU45_09345) | 1842284..1843555 | + | 1272 | WP_001113215.1 | replication-associated recombination protein A | - |
OTU45_RS09355 (OTU45_09355) | 1844102..1845421 | - | 1320 | WP_000608880.1 | glycoside hydrolase family 32 protein | - |
OTU45_RS09360 (OTU45_09360) | 1845431..1846276 | - | 846 | WP_000819520.1 | carbohydrate ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.95 Da Isoelectric Point: 11.0174
>T265426 WP_001132282.1 NZ_CP113114:c1841294-1841115 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERLITIPHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERLITIPHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT265426 WP_000961810.1 NZ_CP113114:c1841078-1840626 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E7SUI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0IC64 |