Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 5632594..5633099 | Replicon | chromosome |
Accession | NZ_CP113106 | ||
Organism | Pseudomonas aeruginosa strain BIAI 157 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | OSZ59_RS26525 | Protein ID | WP_003083773.1 |
Coordinates | 5632818..5633099 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | OSZ59_RS26520 | Protein ID | WP_003083775.1 |
Coordinates | 5632594..5632821 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSZ59_RS26495 (OSZ59_26495) | 5627612..5629105 | + | 1494 | WP_016263977.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
OSZ59_RS26500 (OSZ59_26500) | 5629274..5630701 | + | 1428 | WP_267749919.1 | GABA permease | - |
OSZ59_RS26505 (OSZ59_26505) | 5630783..5631124 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
OSZ59_RS26510 (OSZ59_26510) | 5631197..5631697 | - | 501 | WP_003112629.1 | LEA type 2 family protein | - |
OSZ59_RS26515 (OSZ59_26515) | 5631798..5632418 | + | 621 | WP_003101226.1 | hypothetical protein | - |
OSZ59_RS26520 (OSZ59_26520) | 5632594..5632821 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OSZ59_RS26525 (OSZ59_26525) | 5632818..5633099 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
OSZ59_RS26530 (OSZ59_26530) | 5633399..5634308 | + | 910 | Protein_5242 | LysR family transcriptional regulator | - |
OSZ59_RS26535 (OSZ59_26535) | 5634340..5634750 | - | 411 | WP_003101225.1 | aegerolysin family protein | - |
OSZ59_RS26540 (OSZ59_26540) | 5634930..5635664 | - | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
OSZ59_RS26545 (OSZ59_26545) | 5635765..5636451 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
OSZ59_RS26550 (OSZ59_26550) | 5636500..5637849 | - | 1350 | WP_079279937.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T265424 WP_003083773.1 NZ_CP113106:5632818-5633099 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|