Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 246292..246932 Replicon chromosome
Accession NZ_CP113106
Organism Pseudomonas aeruginosa strain BIAI 157

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OSZ59_RS01180 Protein ID WP_003105740.1
Coordinates 246522..246932 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q6X2S2
Locus tag OSZ59_RS01175 Protein ID WP_003158175.1
Coordinates 246292..246522 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSZ59_RS01160 (OSZ59_01160) 241490..243379 - 1890 WP_003105732.1 hypothetical protein -
OSZ59_RS01165 (OSZ59_01165) 243600..243809 - 210 WP_003105733.1 cold-shock protein -
OSZ59_RS01170 (OSZ59_01170) 244117..246036 - 1920 WP_004352838.1 type I DNA topoisomerase -
OSZ59_RS01175 (OSZ59_01175) 246292..246522 + 231 WP_003158175.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OSZ59_RS01180 (OSZ59_01180) 246522..246932 + 411 WP_003105740.1 tRNA(fMet)-specific endonuclease VapC Toxin
OSZ59_RS01185 (OSZ59_01185) 246954..247214 + 261 WP_003105742.1 hypothetical protein -
OSZ59_RS01190 (OSZ59_01190) 247414..247632 + 219 WP_003105747.1 hypothetical protein -
OSZ59_RS01195 (OSZ59_01195) 247698..247895 - 198 WP_003109353.1 CrpP family ICE-associated protein -
OSZ59_RS01200 (OSZ59_01200) 248051..248539 - 489 WP_003105748.1 single-stranded DNA-binding protein -
OSZ59_RS01205 (OSZ59_01205) 248569..249408 - 840 WP_003105750.1 Rha family transcriptional regulator -
OSZ59_RS01210 (OSZ59_01210) 249455..250003 - 549 WP_003105753.1 DUF3158 family protein -
OSZ59_RS01215 (OSZ59_01215) 250009..250737 - 729 WP_003105754.1 TIGR03761 family integrating conjugative element protein -
OSZ59_RS01220 (OSZ59_01220) 250893..251063 - 171 WP_003159716.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 176446..266503 90057


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-35)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15450.81 Da        Isoelectric Point: 7.3233

>T265420 WP_003105740.1 NZ_CP113106:246522-246932 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8480.41 Da        Isoelectric Point: 4.2821

>AT265420 WP_003158175.1 NZ_CP113106:246292-246522 [Pseudomonas aeruginosa]
MEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVVVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q6X2S2

References