Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 246292..246932 | Replicon | chromosome |
| Accession | NZ_CP113106 | ||
| Organism | Pseudomonas aeruginosa strain BIAI 157 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OSZ59_RS01180 | Protein ID | WP_003105740.1 |
| Coordinates | 246522..246932 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q6X2S2 |
| Locus tag | OSZ59_RS01175 | Protein ID | WP_003158175.1 |
| Coordinates | 246292..246522 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSZ59_RS01160 (OSZ59_01160) | 241490..243379 | - | 1890 | WP_003105732.1 | hypothetical protein | - |
| OSZ59_RS01165 (OSZ59_01165) | 243600..243809 | - | 210 | WP_003105733.1 | cold-shock protein | - |
| OSZ59_RS01170 (OSZ59_01170) | 244117..246036 | - | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
| OSZ59_RS01175 (OSZ59_01175) | 246292..246522 | + | 231 | WP_003158175.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OSZ59_RS01180 (OSZ59_01180) | 246522..246932 | + | 411 | WP_003105740.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| OSZ59_RS01185 (OSZ59_01185) | 246954..247214 | + | 261 | WP_003105742.1 | hypothetical protein | - |
| OSZ59_RS01190 (OSZ59_01190) | 247414..247632 | + | 219 | WP_003105747.1 | hypothetical protein | - |
| OSZ59_RS01195 (OSZ59_01195) | 247698..247895 | - | 198 | WP_003109353.1 | CrpP family ICE-associated protein | - |
| OSZ59_RS01200 (OSZ59_01200) | 248051..248539 | - | 489 | WP_003105748.1 | single-stranded DNA-binding protein | - |
| OSZ59_RS01205 (OSZ59_01205) | 248569..249408 | - | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
| OSZ59_RS01210 (OSZ59_01210) | 249455..250003 | - | 549 | WP_003105753.1 | DUF3158 family protein | - |
| OSZ59_RS01215 (OSZ59_01215) | 250009..250737 | - | 729 | WP_003105754.1 | TIGR03761 family integrating conjugative element protein | - |
| OSZ59_RS01220 (OSZ59_01220) | 250893..251063 | - | 171 | WP_003159716.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 176446..266503 | 90057 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15450.81 Da Isoelectric Point: 7.3233
>T265420 WP_003105740.1 NZ_CP113106:246522-246932 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|