Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2777175..2777963 | Replicon | chromosome |
| Accession | NZ_CP113105 | ||
| Organism | Staphylococcus aureus strain BIAI 117 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A2I7Y5B3 |
| Locus tag | OSZ56_RS13710 | Protein ID | WP_000525004.1 |
| Coordinates | 2777175..2777636 (-) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | OSZ56_RS13715 | Protein ID | WP_000333630.1 |
| Coordinates | 2777649..2777963 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSZ56_RS13685 (2772762) | 2772762..2773292 | + | 531 | WP_000184383.1 | acyl-CoA thioesterase | - |
| OSZ56_RS13690 (2773552) | 2773552..2774697 | - | 1146 | WP_267810370.1 | radical SAM/CxCxxxxC motif protein YfkAB | - |
| OSZ56_RS13695 (2774742) | 2774742..2775788 | - | 1047 | WP_001145721.1 | tyrosine-type recombinase/integrase | - |
| OSZ56_RS13700 (2775901) | 2775901..2776080 | + | 180 | WP_000337827.1 | hypothetical protein | - |
| OSZ56_RS13705 (2776060) | 2776060..2776991 | - | 932 | Protein_2659 | hypothetical protein | - |
| OSZ56_RS13710 (2777175) | 2777175..2777636 | - | 462 | WP_000525004.1 | hypothetical protein | Toxin |
| OSZ56_RS13715 (2777649) | 2777649..2777963 | - | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OSZ56_RS13720 (2778115) | 2778115..2778351 | + | 237 | WP_001121116.1 | helix-turn-helix transcriptional regulator | - |
| OSZ56_RS13725 (2778365) | 2778365..2778544 | + | 180 | WP_000438352.1 | hypothetical protein | - |
| OSZ56_RS13730 (2778645) | 2778645..2779127 | - | 483 | WP_000394410.1 | hypothetical protein | - |
| OSZ56_RS13735 (2779187) | 2779187..2779939 | + | 753 | WP_054249691.1 | phage antirepressor KilAC domain-containing protein | - |
| OSZ56_RS13740 (2779955) | 2779955..2780098 | + | 144 | WP_000939502.1 | hypothetical protein | - |
| OSZ56_RS13745 (2780108) | 2780108..2780761 | - | 654 | WP_001556705.1 | hypothetical protein | - |
| OSZ56_RS13750 (2780832) | 2780832..2781053 | + | 222 | WP_000594789.1 | hypothetical protein | - |
| OSZ56_RS13755 (2781046) | 2781046..2781207 | + | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| OSZ56_RS13760 (2781304) | 2781304..2781564 | + | 261 | WP_000291090.1 | DUF1108 family protein | - |
| OSZ56_RS13765 (2781574) | 2781574..2781795 | + | 222 | WP_000815403.1 | DUF2483 family protein | - |
| OSZ56_RS13770 (2781788) | 2781788..2782576 | + | 789 | WP_000134097.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T265418 WP_000525004.1 NZ_CP113105:c2777636-2777175 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |