Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 2777175..2777963 Replicon chromosome
Accession NZ_CP113105
Organism Staphylococcus aureus strain BIAI 117

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag OSZ56_RS13710 Protein ID WP_000525004.1
Coordinates 2777175..2777636 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag OSZ56_RS13715 Protein ID WP_000333630.1
Coordinates 2777649..2777963 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSZ56_RS13685 (2772762) 2772762..2773292 + 531 WP_000184383.1 acyl-CoA thioesterase -
OSZ56_RS13690 (2773552) 2773552..2774697 - 1146 WP_267810370.1 radical SAM/CxCxxxxC motif protein YfkAB -
OSZ56_RS13695 (2774742) 2774742..2775788 - 1047 WP_001145721.1 tyrosine-type recombinase/integrase -
OSZ56_RS13700 (2775901) 2775901..2776080 + 180 WP_000337827.1 hypothetical protein -
OSZ56_RS13705 (2776060) 2776060..2776991 - 932 Protein_2659 hypothetical protein -
OSZ56_RS13710 (2777175) 2777175..2777636 - 462 WP_000525004.1 hypothetical protein Toxin
OSZ56_RS13715 (2777649) 2777649..2777963 - 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
OSZ56_RS13720 (2778115) 2778115..2778351 + 237 WP_001121116.1 helix-turn-helix transcriptional regulator -
OSZ56_RS13725 (2778365) 2778365..2778544 + 180 WP_000438352.1 hypothetical protein -
OSZ56_RS13730 (2778645) 2778645..2779127 - 483 WP_000394410.1 hypothetical protein -
OSZ56_RS13735 (2779187) 2779187..2779939 + 753 WP_054249691.1 phage antirepressor KilAC domain-containing protein -
OSZ56_RS13740 (2779955) 2779955..2780098 + 144 WP_000939502.1 hypothetical protein -
OSZ56_RS13745 (2780108) 2780108..2780761 - 654 WP_001556705.1 hypothetical protein -
OSZ56_RS13750 (2780832) 2780832..2781053 + 222 WP_000594789.1 hypothetical protein -
OSZ56_RS13755 (2781046) 2781046..2781207 + 162 WP_000066011.1 DUF1270 domain-containing protein -
OSZ56_RS13760 (2781304) 2781304..2781564 + 261 WP_000291090.1 DUF1108 family protein -
OSZ56_RS13765 (2781574) 2781574..2781795 + 222 WP_000815403.1 DUF2483 family protein -
OSZ56_RS13770 (2781788) 2781788..2782576 + 789 WP_000134097.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T265418 WP_000525004.1 NZ_CP113105:c2777636-2777175 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT265418 WP_000333630.1 NZ_CP113105:c2777963-2777649 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References