Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2586464..2586993 | Replicon | chromosome |
Accession | NZ_CP113105 | ||
Organism | Staphylococcus aureus strain BIAI 117 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q6GF05 |
Locus tag | OSZ56_RS12590 | Protein ID | WP_000621176.1 |
Coordinates | 2586631..2586993 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OSZ56_RS12585 | Protein ID | WP_000948331.1 |
Coordinates | 2586464..2586634 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSZ56_RS12555 (2581500) | 2581500..2582060 | + | 561 | WP_001092414.1 | K(+)-transporting ATPase subunit C | - |
OSZ56_RS12560 (2582269) | 2582269..2582748 | + | 480 | WP_267810343.1 | hypothetical protein | - |
OSZ56_RS12565 (2582741) | 2582741..2584318 | + | 1578 | WP_001294646.1 | PH domain-containing protein | - |
OSZ56_RS12570 (2584311) | 2584311..2584802 | + | 492 | WP_001286801.1 | PH domain-containing protein | - |
OSZ56_RS12575 (2584806) | 2584806..2585165 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
OSZ56_RS12580 (2585231) | 2585231..2586379 | + | 1149 | WP_001281140.1 | alanine racemase | - |
OSZ56_RS12585 (2586464) | 2586464..2586634 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OSZ56_RS12590 (2586631) | 2586631..2586993 | + | 363 | WP_000621176.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OSZ56_RS12595 (2587342) | 2587342..2588343 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OSZ56_RS12600 (2588462) | 2588462..2588788 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OSZ56_RS12605 (2588790) | 2588790..2589269 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
OSZ56_RS12610 (2589244) | 2589244..2590014 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 10.1654
>T265414 WP_000621176.1 NZ_CP113105:2586631-2586993 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A168PYX0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0VRZ1 |