Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2586464..2586993 Replicon chromosome
Accession NZ_CP113105
Organism Staphylococcus aureus strain BIAI 117

Toxin (Protein)


Gene name mazF Uniprot ID Q6GF05
Locus tag OSZ56_RS12590 Protein ID WP_000621176.1
Coordinates 2586631..2586993 (+) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag OSZ56_RS12585 Protein ID WP_000948331.1
Coordinates 2586464..2586634 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSZ56_RS12555 (2581500) 2581500..2582060 + 561 WP_001092414.1 K(+)-transporting ATPase subunit C -
OSZ56_RS12560 (2582269) 2582269..2582748 + 480 WP_267810343.1 hypothetical protein -
OSZ56_RS12565 (2582741) 2582741..2584318 + 1578 WP_001294646.1 PH domain-containing protein -
OSZ56_RS12570 (2584311) 2584311..2584802 + 492 WP_001286801.1 PH domain-containing protein -
OSZ56_RS12575 (2584806) 2584806..2585165 + 360 WP_000581197.1 holo-ACP synthase -
OSZ56_RS12580 (2585231) 2585231..2586379 + 1149 WP_001281140.1 alanine racemase -
OSZ56_RS12585 (2586464) 2586464..2586634 + 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
OSZ56_RS12590 (2586631) 2586631..2586993 + 363 WP_000621176.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OSZ56_RS12595 (2587342) 2587342..2588343 + 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
OSZ56_RS12600 (2588462) 2588462..2588788 + 327 WP_001052491.1 anti-sigma factor antagonist -
OSZ56_RS12605 (2588790) 2588790..2589269 + 480 WP_001190825.1 anti-sigma B factor RsbW -
OSZ56_RS12610 (2589244) 2589244..2590014 + 771 WP_001041107.1 RNA polymerase sigma factor SigB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13469.74 Da        Isoelectric Point: 10.1654

>T265414 WP_000621176.1 NZ_CP113105:2586631-2586993 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT265414 WP_000948331.1 NZ_CP113105:2586464-2586634 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A168PYX0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References