265406

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1051576..1052053 Replicon chromosome
Accession NZ_CP113105
Organism Staphylococcus aureus strain BIAI 117

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag OSZ56_RS05150 Protein ID WP_000052076.1
Coordinates 1051865..1052053 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OSZ56_RS05145 Protein ID WP_001059690.1
Coordinates 1051576..1051836 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSZ56_RS05110 (1046968) 1046968..1047684 - 717 WP_061843141.1 type I 3-dehydroquinate dehydratase -
OSZ56_RS05115 (1047832) 1047832..1048254 + 423 WP_061843140.1 organic hydroperoxide resistance protein -
OSZ56_RS05120 (1048653) 1048653..1049147 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
OSZ56_RS05125 (1049303) 1049303..1049920 + 618 WP_000255548.1 LysE/ArgO family amino acid transporter -
OSZ56_RS05130 (1049993) 1049993..1050574 - 582 WP_001140696.1 histidine phosphatase family protein -
OSZ56_RS05135 (1050799) 1050799..1051035 + 237 WP_000368687.1 hypothetical protein -
OSZ56_RS05140 (1051032) 1051032..1051235 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OSZ56_RS05145 (1051576) 1051576..1051836 + 261 WP_001059690.1 hypothetical protein Antitoxin
OSZ56_RS05150 (1051865) 1051865..1052053 + 189 WP_000052076.1 hypothetical protein Toxin
OSZ56_RS05155 (1052241) 1052241..1052810 + 570 WP_001106663.1 lipoprotein N-acylation protein LnsA -
OSZ56_RS05160 (1052898) 1052898..1053182 + 285 WP_001004401.1 hypothetical protein -
OSZ56_RS05165 (1053244) 1053244..1053462 + 219 WP_000005879.1 hypothetical protein -
OSZ56_RS05170 (1053959) 1053959..1054159 - 201 WP_001059082.1 cold-shock protein -
OSZ56_RS05175 (1054516) 1054516..1055202 - 687 WP_001574556.1 thermonuclease family protein -
OSZ56_RS05180 (1055543) 1055543..1056100 - 558 WP_000824491.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / sell / sec / tsst-1 1048653..1085721 37068


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T265406 WP_000052076.1 NZ_CP113105:1051865-1052053 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265406 WP_001059690.1 NZ_CP113105:1051576-1051836 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References