Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5549065..5549762 | Replicon | chromosome |
Accession | NZ_CP113097 | ||
Organism | Pseudomonas putida strain WYTS.T61 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OSW16_RS25590 | Protein ID | WP_267819423.1 |
Coordinates | 5549583..5549762 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OSW16_RS25585 | Protein ID | WP_267819421.1 |
Coordinates | 5549065..5549472 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSW16_RS25565 (OSW16_25565) | 5544248..5545120 | + | 873 | WP_267819413.1 | hypothetical protein | - |
OSW16_RS25570 (OSW16_25570) | 5545117..5545890 | + | 774 | WP_267819415.1 | FAD-dependent thymidylate synthase | - |
OSW16_RS25575 (OSW16_25575) | 5545955..5547535 | - | 1581 | WP_267819417.1 | TIGR04141 family sporadically distributed protein | - |
OSW16_RS25580 (OSW16_25580) | 5548073..5548720 | + | 648 | WP_267819419.1 | hypothetical protein | - |
OSW16_RS25585 (OSW16_25585) | 5549065..5549472 | - | 408 | WP_267819421.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OSW16_RS25590 (OSW16_25590) | 5549583..5549762 | - | 180 | WP_267819423.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OSW16_RS25595 (OSW16_25595) | 5550283..5551572 | - | 1290 | WP_267819426.1 | OprD family porin | - |
OSW16_RS25600 (OSW16_25600) | 5552047..5552244 | - | 198 | WP_241805553.1 | hypothetical protein | - |
OSW16_RS25605 (OSW16_25605) | 5552425..5553531 | - | 1107 | WP_267819429.1 | agmatine deiminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6695.87 Da Isoelectric Point: 10.9062
>T265403 WP_267819423.1 NZ_CP113097:c5549762-5549583 [Pseudomonas putida]
VNSRELIARIEADGWVEVRVKGSHHHFKHPTKPGLVTIPHPKKDLLLKTINSILKQAQL
VNSRELIARIEADGWVEVRVKGSHHHFKHPTKPGLVTIPHPKKDLLLKTINSILKQAQL
Download Length: 180 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14580.53 Da Isoelectric Point: 4.5209
>AT265403 WP_267819421.1 NZ_CP113097:c5549472-5549065 [Pseudomonas putida]
VLYPIAILPGDEQHAWGVEVPDIPGCFSAGDDLDDALAMAKEAIEGHLELLAEDGAVIPTANKLTVHSANPEYAGCTWAV
VDIDITKYLGKAEKLNITLPGHLLNRIDEYVKHHPEQKSRSGFLASAALRVLQES
VLYPIAILPGDEQHAWGVEVPDIPGCFSAGDDLDDALAMAKEAIEGHLELLAEDGAVIPTANKLTVHSANPEYAGCTWAV
VDIDITKYLGKAEKLNITLPGHLLNRIDEYVKHHPEQKSRSGFLASAALRVLQES
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|