Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3368593..3369236 | Replicon | chromosome |
Accession | NZ_CP113096 | ||
Organism | Pseudomonas citronellolis strain G5Li.T10 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OSS47_RS15400 | Protein ID | WP_267853822.1 |
Coordinates | 3368593..3369006 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | W5IS21 |
Locus tag | OSS47_RS15405 | Protein ID | WP_009620639.1 |
Coordinates | 3369006..3369236 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSS47_RS15380 (OSS47_15380) | 3363936..3365258 | - | 1323 | WP_267853820.1 | aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | - |
OSS47_RS15385 (OSS47_15385) | 3365255..3366319 | - | 1065 | WP_267853821.1 | phosphotransferase | - |
OSS47_RS15390 (OSS47_15390) | 3366472..3367206 | + | 735 | WP_009620642.1 | SDR family oxidoreductase | - |
OSS47_RS15395 (OSS47_15395) | 3367270..3367959 | + | 690 | WP_061560910.1 | GntR family transcriptional regulator | - |
OSS47_RS15400 (OSS47_15400) | 3368593..3369006 | - | 414 | WP_267853822.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
OSS47_RS15405 (OSS47_15405) | 3369006..3369236 | - | 231 | WP_009620639.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OSS47_RS15410 (OSS47_15410) | 3369369..3370070 | - | 702 | WP_009620638.1 | ATP-binding cassette domain-containing protein | - |
OSS47_RS15415 (OSS47_15415) | 3370074..3370841 | - | 768 | WP_009620637.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
OSS47_RS15420 (OSS47_15420) | 3370838..3372091 | - | 1254 | WP_043314177.1 | high-affinity branched-chain amino acid ABC transporter permease LivM | - |
OSS47_RS15425 (OSS47_15425) | 3372088..3373008 | - | 921 | WP_009620635.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15167.46 Da Isoelectric Point: 6.6409
>T265395 WP_267853822.1 NZ_CP113096:c3369006-3368593 [Pseudomonas citronellolis]
MLKFMLDTNICIFTIKNKPQVVREAFNQHHGQLAISSVTLMELIYGAEKSSMPEHNLGIVEGFAARLEVLDYDGNAAAHT
GQLRAELARIGKPIGPYDQMIAGHARSRGLILVSNNLREFEQVPGLRLEDWTVAPSP
MLKFMLDTNICIFTIKNKPQVVREAFNQHHGQLAISSVTLMELIYGAEKSSMPEHNLGIVEGFAARLEVLDYDGNAAAHT
GQLRAELARIGKPIGPYDQMIAGHARSRGLILVSNNLREFEQVPGLRLEDWTVAPSP
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|