Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 3227250..3227858 | Replicon | chromosome |
Accession | NZ_CP113096 | ||
Organism | Pseudomonas citronellolis strain G5Li.T10 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A1S1GNG8 |
Locus tag | OSS47_RS14745 | Protein ID | WP_043272446.1 |
Coordinates | 3227250..3227597 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | OSS47_RS14750 | Protein ID | WP_081884705.1 |
Coordinates | 3227607..3227858 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSS47_RS14730 (OSS47_14730) | 3224007..3224681 | - | 675 | WP_009618249.1 | DUF4194 domain-containing protein | - |
OSS47_RS14735 (OSS47_14735) | 3224713..3226185 | - | 1473 | WP_009618251.1 | DUF3375 domain-containing protein | - |
OSS47_RS14740 (OSS47_14740) | 3226281..3226886 | - | 606 | WP_009618253.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
OSS47_RS14745 (OSS47_14745) | 3227250..3227597 | - | 348 | WP_043272446.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OSS47_RS14750 (OSS47_14750) | 3227607..3227858 | - | 252 | WP_081884705.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OSS47_RS14755 (OSS47_14755) | 3228316..3229731 | + | 1416 | WP_267853790.1 | amino acid permease | - |
OSS47_RS14760 (OSS47_14760) | 3229857..3230393 | + | 537 | WP_043272448.1 | 2,4'-dihydroxyacetophenone dioxygenase family protein | - |
OSS47_RS14765 (OSS47_14765) | 3230450..3231355 | + | 906 | WP_267853791.1 | LysR family transcriptional regulator | - |
OSS47_RS14770 (OSS47_14770) | 3231418..3232659 | + | 1242 | WP_267853792.1 | aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12935.75 Da Isoelectric Point: 4.6337
>T265394 WP_043272446.1 NZ_CP113096:c3227597-3227250 [Pseudomonas citronellolis]
MSKVVIRLTDTAEQSIEDQVHHLAQFQGSQAALQSVLSLLDEIEEKISLTPQGYPISQQASLLGVLNYRELNTGPYRVFY
ELHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIG
MSKVVIRLTDTAEQSIEDQVHHLAQFQGSQAALQSVLSLLDEIEEKISLTPQGYPISQQASLLGVLNYRELNTGPYRVFY
ELHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIG
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|