Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2498627..2499246 | Replicon | chromosome |
| Accession | NZ_CP113096 | ||
| Organism | Pseudomonas citronellolis strain G5Li.T10 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | W5J3G4 |
| Locus tag | OSS47_RS11275 | Protein ID | WP_009615522.1 |
| Coordinates | 2498627..2498809 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OSS47_RS11280 | Protein ID | WP_043319209.1 |
| Coordinates | 2498842..2499246 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSS47_RS11265 (OSS47_11265) | 2497221..2497379 | + | 159 | WP_009615518.1 | YqaE/Pmp3 family membrane protein | - |
| OSS47_RS11270 (OSS47_11270) | 2497680..2498168 | - | 489 | WP_043319207.1 | Bro-N domain-containing protein | - |
| OSS47_RS11275 (OSS47_11275) | 2498627..2498809 | + | 183 | WP_009615522.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OSS47_RS11280 (OSS47_11280) | 2498842..2499246 | + | 405 | WP_043319209.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OSS47_RS11285 (OSS47_11285) | 2499341..2499595 | + | 255 | WP_043270302.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OSS47_RS11290 (OSS47_11290) | 2499595..2500020 | + | 426 | WP_043319303.1 | type II toxin-antitoxin system VapC family toxin | - |
| OSS47_RS11295 (OSS47_11295) | 2500040..2501224 | - | 1185 | WP_052267964.1 | Fic family protein | - |
| OSS47_RS11300 (OSS47_11300) | 2502000..2502794 | - | 795 | WP_267853685.1 | hypothetical protein | - |
| OSS47_RS11305 (OSS47_11305) | 2503228..2503434 | - | 207 | WP_267853686.1 | hypothetical protein | - |
| OSS47_RS11310 (OSS47_11310) | 2503435..2503968 | - | 534 | WP_267853687.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | pilT / pilU / pilG / pilH / pilI / pilJ / pilK / chpB / chpC / chpD / chpE / acrB | 2266075..2513008 | 246933 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6962.13 Da Isoelectric Point: 12.2993
>T265391 WP_009615522.1 NZ_CP113096:2498627-2498809 [Pseudomonas citronellolis]
MRSREIMELIRADGWFLVEVKGSHHQFRHFTKKGRVTVPHPRSNLPIGTVNSILRQAGLR
MRSREIMELIRADGWFLVEVKGSHHQFRHFTKKGRVTVPHPRSNLPIGTVNSILRQAGLR
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14505.21 Da Isoelectric Point: 4.5714
>AT265391 WP_043319209.1 NZ_CP113096:2498842-2499246 [Pseudomonas citronellolis]
MKFPVVLHKDADSDYGVTIPDVPGCFSAGGTVSQALENVQEALALHFEGLVADGETLPQAQEVDTHMGNPDYAGGVWAVV
DFDVTPYLGKAVRFNASLPENLLQRIDERVKRDHRYASRSGFLATAALRELSSS
MKFPVVLHKDADSDYGVTIPDVPGCFSAGGTVSQALENVQEALALHFEGLVADGETLPQAQEVDTHMGNPDYAGGVWAVV
DFDVTPYLGKAVRFNASLPENLLQRIDERVKRDHRYASRSGFLATAALRELSSS
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|