Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 2481151..2481769 | Replicon | chromosome |
| Accession | NZ_CP113096 | ||
| Organism | Pseudomonas citronellolis strain G5Li.T10 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | A0A1A9KN07 |
| Locus tag | OSS47_RS11210 | Protein ID | WP_058073322.1 |
| Coordinates | 2481151..2481456 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | OSS47_RS11215 | Protein ID | WP_043269347.1 |
| Coordinates | 2481449..2481769 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSS47_RS11185 (OSS47_11185) | 2476160..2476885 | + | 726 | WP_043269359.1 | alpha/beta fold hydrolase | - |
| OSS47_RS11190 (OSS47_11190) | 2476878..2477684 | + | 807 | WP_043269357.1 | malonyl-ACP O-methyltransferase BioC | - |
| OSS47_RS11195 (OSS47_11195) | 2477835..2478524 | + | 690 | WP_009615494.1 | dethiobiotin synthase | - |
| OSS47_RS11200 (OSS47_11200) | 2478591..2478818 | + | 228 | WP_009615495.1 | hypothetical protein | - |
| OSS47_RS11205 (OSS47_11205) | 2479123..2480928 | + | 1806 | WP_043319187.1 | phenylacyl-CoA dehydrogenase | - |
| OSS47_RS11210 (OSS47_11210) | 2481151..2481456 | + | 306 | WP_058073322.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OSS47_RS11215 (OSS47_11215) | 2481449..2481769 | + | 321 | WP_043269347.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OSS47_RS11220 (OSS47_11220) | 2481939..2483735 | + | 1797 | WP_043319190.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
| OSS47_RS11225 (OSS47_11225) | 2483954..2485732 | + | 1779 | WP_043319192.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | pilT / pilU / pilG / pilH / pilI / pilJ / pilK / chpB / chpC / chpD / chpE / acrB | 2266075..2513008 | 246933 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11249.67 Da Isoelectric Point: 7.0609
>T265390 WP_058073322.1 NZ_CP113096:2481151-2481456 [Pseudomonas citronellolis]
MPDDVQDVFGFALHQAQEGGKHPQAKPMKGFSGAGVLEVVEDHDGDTYRAVYTVKFARAVYALHCFQKKSTKGIETPQHD
LELIRKRLKDAQAHAKSVEND
MPDDVQDVFGFALHQAQEGGKHPQAKPMKGFSGAGVLEVVEDHDGDTYRAVYTVKFARAVYALHCFQKKSTKGIETPQHD
LELIRKRLKDAQAHAKSVEND
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|