Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 1967080..1967585 Replicon chromosome
Accession NZ_CP113096
Organism Pseudomonas citronellolis strain G5Li.T10

Toxin (Protein)


Gene name parE Uniprot ID W5IQ81
Locus tag OSS47_RS08945 Protein ID WP_009614629.1
Coordinates 1967080..1967361 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID W5IQE2
Locus tag OSS47_RS08950 Protein ID WP_009614631.1
Coordinates 1967358..1967585 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSS47_RS08915 (OSS47_08915) 1962434..1963636 + 1203 WP_267853613.1 zinc metallochaperone GTPase ZigA -
OSS47_RS08920 (OSS47_08920) 1963636..1964253 + 618 WP_043312505.1 DUF1826 domain-containing protein -
OSS47_RS08925 (OSS47_08925) 1964250..1964705 - 456 WP_267853614.1 GNAT family N-acetyltransferase -
OSS47_RS08930 (OSS47_08930) 1964764..1965681 - 918 WP_043312499.1 LysR family transcriptional regulator -
OSS47_RS08935 (OSS47_08935) 1965779..1966060 + 282 WP_064581559.1 DUF2218 domain-containing protein -
OSS47_RS08940 (OSS47_08940) 1966101..1966820 - 720 WP_267853615.1 RcnB family protein -
OSS47_RS08945 (OSS47_08945) 1967080..1967361 - 282 WP_009614629.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OSS47_RS08950 (OSS47_08950) 1967358..1967585 - 228 WP_009614631.1 CopG family ribbon-helix-helix protein Antitoxin
OSS47_RS08955 (OSS47_08955) 1967866..1968822 + 957 WP_267853616.1 agmatinase -
OSS47_RS08960 (OSS47_08960) 1968897..1969823 + 927 WP_009614635.1 LysR family transcriptional regulator -
OSS47_RS08965 (OSS47_08965) 1969820..1970551 + 732 WP_267853617.1 phytanoyl-CoA dioxygenase family protein -
OSS47_RS08970 (OSS47_08970) 1970563..1970964 + 402 WP_009614637.1 GFA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10251.74 Da        Isoelectric Point: 6.4614

>T265389 WP_009614629.1 NZ_CP113096:c1967361-1967080 [Pseudomonas citronellolis]
MSLQWTHKAAADLDGLYDHYVVLIGPEKALKAIQDVVGQVKALADLSLSSVGRPSEVPGVRELPLERWPYQAAYRVKGRD
VQILRIDSVDNPG

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8357.42 Da        Isoelectric Point: 6.6405

>AT265389 WP_009614631.1 NZ_CP113096:c1967585-1967358 [Pseudomonas citronellolis]
MTTVISFRADDALAKALDQLARATHRDRPYHLRQALAQYLERQSWHVAAIDEGLADANAGHLLPHAEIEAKWGLA

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1A5D1B8

Antitoxin

Source ID Structure
AlphaFold DB A0A1S1GJG7

References