Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 82550..83085 Replicon plasmid unnamed2
Accession NZ_CP113087
Organism Pantoea agglomerans strain AB378

Toxin (Protein)


Gene name relE Uniprot ID A0A8X8DPA1
Locus tag OSE17_RS21780 Protein ID WP_010257115.1
Coordinates 82798..83085 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OSE17_RS21775 Protein ID WP_039387444.1
Coordinates 82550..82801 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSE17_RS21755 (OSE17_21755) 78153..78422 - 270 WP_010257103.1 DUF1471 family periplasmic protein YahO -
OSE17_RS21760 (OSE17_21760) 78698..79834 - 1137 WP_033786324.1 HlyD family secretion protein -
OSE17_RS21765 (OSE17_21765) 79836..80162 - 327 WP_010257107.1 DUF3302 domain-containing protein -
OSE17_RS21770 (OSE17_21770) 80757..82409 + 1653 WP_191914332.1 intermembrane transport protein PqiB -
OSE17_RS21775 (OSE17_21775) 82550..82801 + 252 WP_039387444.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OSE17_RS21780 (OSE17_21780) 82798..83085 + 288 WP_010257115.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OSE17_RS21785 (OSE17_21785) 83448..83762 + 315 WP_031593845.1 hypothetical protein -
OSE17_RS21790 (OSE17_21790) 83759..84577 - 819 WP_167430566.1 DUF4225 domain-containing protein -
OSE17_RS21795 (OSE17_21795) 84955..85245 - 291 WP_022624282.1 XRE family transcriptional regulator -
OSE17_RS21800 (OSE17_21800) 85242..85574 - 333 WP_031292300.1 type II toxin-antitoxin system RelE/ParE family toxin -
OSE17_RS21805 (OSE17_21805) 85694..85969 - 276 Protein_76 SAM-dependent DNA methyltransferase -
OSE17_RS21810 (OSE17_21810) 86138..86338 + 201 WP_249405288.1 hypothetical protein -
OSE17_RS21815 (OSE17_21815) 86443..86808 - 366 WP_158132475.1 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF -
OSE17_RS21820 (OSE17_21820) 86805..87125 - 321 WP_010257131.1 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..183838 183838


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11173.08 Da        Isoelectric Point: 10.3856

>T265384 WP_010257115.1 NZ_CP113087:82798-83085 [Pantoea agglomerans]
VSYTVKFREEAFKEWQKLDKSLQQQFAKKLKKCCDNPHIPSARLRGIKDCYKIKLRASGFRLVYQVIDDQLVIAVVAVGK
RERSDVYHLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9108.38 Da        Isoelectric Point: 3.9507

>AT265384 WP_039387444.1 NZ_CP113087:82550-82801 [Pantoea agglomerans]
MPNIILSDTSASVSELKKNPMATVNAGDGYPVAILNRNQPAFYCVPAELYEQMLDALDDQELVKLVSERSGQRLLDVDLD
ALL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References