Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 305923..306833 | Replicon | plasmid unnamed1 |
Accession | NZ_CP113086 | ||
Organism | Pantoea agglomerans strain AB378 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | OSE17_RS20245 | Protein ID | WP_045139959.1 |
Coordinates | 306363..306833 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A7X5S5X4 |
Locus tag | OSE17_RS20240 | Protein ID | WP_033760867.1 |
Coordinates | 305923..306366 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSE17_RS20215 (OSE17_20215) | 302144..303043 | - | 900 | WP_267713287.1 | alpha/beta hydrolase | - |
OSE17_RS20220 (OSE17_20220) | 303094..303708 | - | 615 | WP_267713288.1 | TetR/AcrR family transcriptional regulator | - |
OSE17_RS20225 (OSE17_20225) | 303922..304339 | + | 418 | Protein_288 | LysR substrate-binding domain-containing protein | - |
OSE17_RS20230 (OSE17_20230) | 304374..305363 | - | 990 | WP_172608587.1 | aldo/keto reductase | - |
OSE17_RS20235 (OSE17_20235) | 305389..305541 | - | 153 | Protein_290 | aldo/keto reductase | - |
OSE17_RS20240 (OSE17_20240) | 305923..306366 | + | 444 | WP_033760867.1 | DUF2384 domain-containing protein | Antitoxin |
OSE17_RS20245 (OSE17_20245) | 306363..306833 | + | 471 | WP_045139959.1 | RES family NAD+ phosphorylase | Toxin |
OSE17_RS20250 (OSE17_20250) | 307005..308036 | + | 1032 | WP_033760863.1 | AI-2E family transporter | - |
OSE17_RS20255 (OSE17_20255) | 308025..310754 | - | 2730 | WP_267713289.1 | cation-transporting P-type ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..555125 | 555125 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17508.98 Da Isoelectric Point: 4.7790
>T265382 WP_045139959.1 NZ_CP113086:306363-306833 [Pantoea agglomerans]
MILYRLTKTKYLSTAWTGFGAKEAGGRWNSIGISMVYVSETASLTLLETLVHLHSAHILDAFTLLRIDVPDVLIQTADIT
ELPANWADEDAPAELADYGDAWCSACDAVALRVPSALSPVEYNYLLNPEHPEFFRIVQQAEAIPFRFDRRLKPDRK
MILYRLTKTKYLSTAWTGFGAKEAGGRWNSIGISMVYVSETASLTLLETLVHLHSAHILDAFTLLRIDVPDVLIQTADIT
ELPANWADEDAPAELADYGDAWCSACDAVALRVPSALSPVEYNYLLNPEHPEFFRIVQQAEAIPFRFDRRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16489.88 Da Isoelectric Point: 9.9250
>AT265382 WP_033760867.1 NZ_CP113086:305923-306366 [Pantoea agglomerans]
MKTFSFSANKTRPPRLWQAAGLNNADGVALLGQINEGLDGNVAHLIVNWAKITQNDLRKMSGIPSTTFSRSVKAKFSAEQ
SERLVRIIRVIDRAVELFEGDKDEAQKWLNEPNRALSWKMPAELMASETGAYEVMKLITRLEHGVYS
MKTFSFSANKTRPPRLWQAAGLNNADGVALLGQINEGLDGNVAHLIVNWAKITQNDLRKMSGIPSTTFSRSVKAKFSAEQ
SERLVRIIRVIDRAVELFEGDKDEAQKWLNEPNRALSWKMPAELMASETGAYEVMKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|