Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 95537..96168 | Replicon | chromosome |
| Accession | NZ_CP113085 | ||
| Organism | Pantoea agglomerans strain AB378 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7X5MR53 |
| Locus tag | OSE17_RS00440 | Protein ID | WP_010253953.1 |
| Coordinates | 95989..96168 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A8X8DTB6 |
| Locus tag | OSE17_RS00435 | Protein ID | WP_010253955.1 |
| Coordinates | 95537..95962 (-) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSE17_RS00415 (OSE17_00415) | 92258..92767 | - | 510 | WP_010253965.1 | phenolic acid decarboxylase | - |
| OSE17_RS00420 (OSE17_00420) | 92873..93772 | + | 900 | WP_172608183.1 | LysR family transcriptional regulator | - |
| OSE17_RS00425 (OSE17_00425) | 94200..95129 | - | 930 | WP_191913914.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| OSE17_RS00430 (OSE17_00430) | 95366..95483 | - | 118 | Protein_81 | subtype I-E CRISPR-associated endonuclease Cas1 | - |
| OSE17_RS00435 (OSE17_00435) | 95537..95962 | - | 426 | WP_010253955.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OSE17_RS00440 (OSE17_00440) | 95989..96168 | - | 180 | WP_010253953.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OSE17_RS00445 (OSE17_00445) | 96351..97775 | - | 1425 | WP_010253950.1 | dihydrolipoyl dehydrogenase | - |
| OSE17_RS00450 (OSE17_00450) | 97936..99837 | - | 1902 | WP_010671838.1 | pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6467.52 Da Isoelectric Point: 10.7891
>T265374 WP_010253953.1 NZ_CP113085:c96168-95989 [Pantoea agglomerans]
MDSSTLISEMKADGWVLTGINGSHHHFTHPTKPGLVTVPHPKKDLPIGTVKSIRKQARI
MDSSTLISEMKADGWVLTGINGSHHHFTHPTKPGLVTVPHPKKDLPIGTVKSIRKQARI
Download Length: 180 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15422.60 Da Isoelectric Point: 4.7662
>AT265374 WP_010253955.1 NZ_CP113085:c95962-95537 [Pantoea agglomerans]
MFYPIAIEAGDHEHAYGVIVPDLPGCFSAGDTLDEAIKNAKEAITGHIELCVELGHEIPAVSTIETLATNPDYQGYIWAL
VDVDVIRLLGGSEKINVTLPRSLIDRIDRCVASHPEYKSRSGFLAQVALERITAPINRPQK
MFYPIAIEAGDHEHAYGVIVPDLPGCFSAGDTLDEAIKNAKEAITGHIELCVELGHEIPAVSTIETLATNPDYQGYIWAL
VDVDVIRLLGGSEKINVTLPRSLIDRIDRCVASHPEYKSRSGFLAQVALERITAPINRPQK
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|