Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 4683947..4684599 | Replicon | chromosome |
| Accession | NZ_CP113083 | ||
| Organism | Rhodopseudomonas palustris strain CGA0092 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q6N2A8 |
| Locus tag | OR798_RS21475 | Protein ID | WP_011159677.1 |
| Coordinates | 4684195..4684599 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q6N2A9 |
| Locus tag | OR798_RS21470 | Protein ID | WP_011159676.1 |
| Coordinates | 4683947..4684198 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR798_RS21460 (OR798_21460) | 4679109..4679492 | - | 384 | WP_011159673.1 | phasin | - |
| OR798_RS21465 (OR798_21465) | 4679817..4683398 | + | 3582 | WP_042441275.1 | histidine kinase dimerization/phospho-acceptor domain-containing protein | - |
| OR798_RS21470 (OR798_21470) | 4683947..4684198 | + | 252 | WP_011159676.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OR798_RS21475 (OR798_21475) | 4684195..4684599 | + | 405 | WP_011159677.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OR798_RS21480 (OR798_21480) | 4684683..4685393 | + | 711 | WP_011159678.1 | Crp/Fnr family transcriptional regulator | - |
| OR798_RS21485 (OR798_21485) | 4685366..4685590 | - | 225 | WP_011159679.1 | DUF1858 domain-containing protein | - |
| OR798_RS21490 (OR798_21490) | 4685828..4686940 | + | 1113 | WP_011159680.1 | copper-containing nitrite reductase | - |
| OR798_RS21495 (OR798_21495) | 4687109..4687990 | + | 882 | WP_011159681.1 | SUMF1/EgtB/PvdO family nonheme iron enzyme | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14406.53 Da Isoelectric Point: 4.8780
>T265373 WP_011159677.1 NZ_CP113083:4684195-4684599 [Rhodopseudomonas palustris]
VIVIDTSAIIAIFREEPEAAQFARLIASDDQPVLSSGNLLETAIVLRGLKDIQPAKAERWLDDFIAEAGIRIEPVTTEQA
GYARSAHLRFGKGTGHKAALNYGDCFAYALAKALNAPLLCKGNDFPLTDIPLVA
VIVIDTSAIIAIFREEPEAAQFARLIASDDQPVLSSGNLLETAIVLRGLKDIQPAKAERWLDDFIAEAGIRIEPVTTEQA
GYARSAHLRFGKGTGHKAALNYGDCFAYALAKALNAPLLCKGNDFPLTDIPLVA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|