Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 4046762..4047618 | Replicon | chromosome |
Accession | NZ_CP113083 | ||
Organism | Rhodopseudomonas palustris strain CGA0092 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | Q6N3W1 |
Locus tag | OR798_RS18565 | Protein ID | WP_011159121.1 |
Coordinates | 4046762..4047292 (-) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q6N3W0 |
Locus tag | OR798_RS18570 | Protein ID | WP_011159122.1 |
Coordinates | 4047280..4047618 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR798_RS18545 (OR798_18545) | 4041988..4043988 | + | 2001 | WP_011159117.1 | phosphomethylpyrimidine synthase ThiC | - |
OR798_RS18550 (OR798_18550) | 4044159..4045034 | + | 876 | WP_011159118.1 | DUF4393 domain-containing protein | - |
OR798_RS18555 (OR798_18555) | 4045292..4046475 | + | 1184 | WP_085977287.1 | IS3-like element ISRpa2 family transposase | - |
OR798_RS18560 (OR798_18560) | 4046498..4046641 | - | 144 | Protein_3669 | DUF6429 family protein | - |
OR798_RS18565 (OR798_18565) | 4046762..4047292 | - | 531 | WP_011159121.1 | GNAT family N-acetyltransferase | Toxin |
OR798_RS18570 (OR798_18570) | 4047280..4047618 | - | 339 | WP_011159122.1 | DUF1778 domain-containing protein | Antitoxin |
OR798_RS18575 (OR798_18575) | 4047797..4048576 | + | 780 | WP_011159123.1 | hypothetical protein | - |
OR798_RS18580 (OR798_18580) | 4048764..4049276 | - | 513 | WP_011159124.1 | hypothetical protein | - |
OR798_RS18585 (OR798_18585) | 4049584..4050003 | - | 420 | WP_234803278.1 | hypothetical protein | - |
OR798_RS18590 (OR798_18590) | 4051246..4051530 | + | 285 | WP_011159126.1 | hypothetical protein | - |
OR798_RS18595 (OR798_18595) | 4051700..4051888 | + | 189 | WP_042441214.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 18929.60 Da Isoelectric Point: 7.7009
>T265371 WP_011159121.1 NZ_CP113083:c4047292-4046762 [Rhodopseudomonas palustris]
MADIDDAPNQPRSRLSAPVPLTIAHDLSAFDCGEPVLNDWLRQRALKNESRFSRTYVVCEGNQVVGYFCVSAGAVERAAA
PGKVRRNAPDAIPVSVIGRLAVSRSHAGIGLGADLLSDALRRIALASQSIGIGAVQVHAKDDAAKRFYLRCAEFIEYPQD
SRTLFLPIETVVAALS
MADIDDAPNQPRSRLSAPVPLTIAHDLSAFDCGEPVLNDWLRQRALKNESRFSRTYVVCEGNQVVGYFCVSAGAVERAAA
PGKVRRNAPDAIPVSVIGRLAVSRSHAGIGLGADLLSDALRRIALASQSIGIGAVQVHAKDDAAKRFYLRCAEFIEYPQD
SRTLFLPIETVVAALS
Download Length: 531 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 12160.97 Da Isoelectric Point: 11.4488
>AT265371 WP_011159122.1 NZ_CP113083:c4047618-4047280 [Rhodopseudomonas palustris]
MAKSRGAPAKSARRSAAAAARGATSDAKGSINLRIETGTRQLIDDAAAVLGKTRTEFMVESARRQAVDVLLDQRLFTLDP
ERYDAFMQALDNPPAPGPKLKALLRRVPAWRT
MAKSRGAPAKSARRSAAAAARGATSDAKGSINLRIETGTRQLIDDAAAVLGKTRTEFMVESARRQAVDVLLDQRLFTLDP
ERYDAFMQALDNPPAPGPKLKALLRRVPAWRT
Download Length: 339 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|