Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 3932745..3933400 | Replicon | chromosome |
| Accession | NZ_CP113083 | ||
| Organism | Rhodopseudomonas palustris strain CGA0092 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OR798_RS18035 | Protein ID | WP_042441199.1 |
| Coordinates | 3932745..3933149 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OR798_RS18040 | Protein ID | WP_042441643.1 |
| Coordinates | 3933146..3933400 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR798_RS18020 (OR798_18020) | 3927760..3928002 | - | 243 | WP_011159021.1 | hypothetical protein | - |
| OR798_RS18025 (OR798_18025) | 3928339..3929562 | + | 1224 | WP_011159022.1 | efflux RND transporter periplasmic adaptor subunit | - |
| OR798_RS18030 (OR798_18030) | 3929565..3932702 | + | 3138 | WP_011159023.1 | multidrug efflux RND transporter permease subunit | - |
| OR798_RS18035 (OR798_18035) | 3932745..3933149 | - | 405 | WP_042441199.1 | PIN domain-containing protein | Toxin |
| OR798_RS18040 (OR798_18040) | 3933146..3933400 | - | 255 | WP_042441643.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| OR798_RS18050 (OR798_18050) | 3933855..3933986 | + | 132 | WP_267793647.1 | hypothetical protein | - |
| OR798_RS18055 (OR798_18055) | 3933997..3935190 | - | 1194 | WP_011159025.1 | CoA transferase | - |
| OR798_RS18060 (OR798_18060) | 3935300..3936511 | - | 1212 | WP_011159026.1 | ABC transporter substrate-binding protein | - |
| OR798_RS18065 (OR798_18065) | 3936760..3937374 | - | 615 | WP_011159027.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14748.64 Da Isoelectric Point: 5.8886
>T265370 WP_042441199.1 NZ_CP113083:c3933149-3932745 [Rhodopseudomonas palustris]
VRAFFDTNILVYSTTSDPRQATAAACLEQGGFASVQVLNEFVHVARRKLRHDWPQIEVALEQFHAALDDVLPITLTTHAA
AVVLARDHRVSFYDALIVAAAQAAGCDVLYSEDLQHGRTFGALRVENPFLEGSR
VRAFFDTNILVYSTTSDPRQATAAACLEQGGFASVQVLNEFVHVARRKLRHDWPQIEVALEQFHAALDDVLPITLTTHAA
AVVLARDHRVSFYDALIVAAAQAAGCDVLYSEDLQHGRTFGALRVENPFLEGSR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|