Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2242809..2243479 | Replicon | chromosome |
Accession | NZ_CP113083 | ||
Organism | Rhodopseudomonas palustris strain CGA0092 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q6N8B2 |
Locus tag | OR798_RS10270 | Protein ID | WP_011157547.1 |
Coordinates | 2242809..2243219 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OR798_RS10275 | Protein ID | WP_011157548.1 |
Coordinates | 2243216..2243479 (-) | Length | 88 a.a. |
Genomic Context
Location: 2239198..2239524 (327 bp)
Type: Others
Protein ID: WP_011157544.1
Type: Others
Protein ID: WP_011157544.1
Location: 2239691..2241481 (1791 bp)
Type: Others
Protein ID: WP_011157545.1
Type: Others
Protein ID: WP_011157545.1
Location: 2241517..2242554 (1038 bp)
Type: Others
Protein ID: WP_042441504.1
Type: Others
Protein ID: WP_042441504.1
Location: 2243660..2244085 (426 bp)
Type: Others
Protein ID: WP_011157549.1
Type: Others
Protein ID: WP_011157549.1
Location: 2246246..2247637 (1392 bp)
Type: Others
Protein ID: WP_011157552.1
Type: Others
Protein ID: WP_011157552.1
Location: 2247634..2248170 (537 bp)
Type: Others
Protein ID: WP_147408398.1
Type: Others
Protein ID: WP_147408398.1
Location: 2248167..2248298 (132 bp)
Type: Others
Protein ID: WP_011157553.1
Type: Others
Protein ID: WP_011157553.1
Location: 2242809..2243219 (411 bp)
Type: Toxin
Protein ID: WP_011157547.1
Type: Toxin
Protein ID: WP_011157547.1
Location: 2243216..2243479 (264 bp)
Type: Antitoxin
Protein ID: WP_011157548.1
Type: Antitoxin
Protein ID: WP_011157548.1
Location: 2244182..2245351 (1170 bp)
Type: Others
Protein ID: WP_011157550.1
Type: Others
Protein ID: WP_011157550.1
Location: 2245537..2245845 (309 bp)
Type: Others
Protein ID: WP_011157551.1
Type: Others
Protein ID: WP_011157551.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR798_RS10255 (OR798_10255) | 2239198..2239524 | + | 327 | WP_011157544.1 | hypothetical protein | - |
OR798_RS10260 (OR798_10260) | 2239691..2241481 | + | 1791 | WP_011157545.1 | sulfatase-like hydrolase/transferase | - |
OR798_RS10265 (OR798_10265) | 2241517..2242554 | + | 1038 | WP_042441504.1 | transporter | - |
OR798_RS10270 (OR798_10270) | 2242809..2243219 | - | 411 | WP_011157547.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OR798_RS10275 (OR798_10275) | 2243216..2243479 | - | 264 | WP_011157548.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OR798_RS10280 (OR798_10280) | 2243660..2244085 | + | 426 | WP_011157549.1 | cupin domain-containing protein | - |
OR798_RS10285 (OR798_10285) | 2244182..2245351 | - | 1170 | WP_011157550.1 | DUF2865 domain-containing protein | - |
OR798_RS10290 (OR798_10290) | 2245537..2245845 | - | 309 | WP_011157551.1 | hypothetical protein | - |
OR798_RS10295 (OR798_10295) | 2246246..2247637 | + | 1392 | WP_011157552.1 | cysteine--tRNA ligase | - |
OR798_RS10300 (OR798_10300) | 2247634..2248170 | + | 537 | WP_147408398.1 | hypothetical protein | - |
OR798_RS10305 (OR798_10305) | 2248167..2248298 | + | 132 | WP_011157553.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15136.48 Da Isoelectric Point: 5.6802
>T265369 WP_011157547.1 NZ_CP113083:c2243219-2242809 [Rhodopseudomonas palustris]
MSGWMLDTNVASHVIRGDRREIIERLVALPISDVVISSITEGELLYGLAKRGYPTALSERVREFLLRVDVLPWDHEVTKT
YADLRAVCEAKGVTLSPLDMMIAAHAAATNATLVTRDKAFSRVPSPLRIEDWAEMS
MSGWMLDTNVASHVIRGDRREIIERLVALPISDVVISSITEGELLYGLAKRGYPTALSERVREFLLRVDVLPWDHEVTKT
YADLRAVCEAKGVTLSPLDMMIAAHAAATNATLVTRDKAFSRVPSPLRIEDWAEMS
Download Length: 411 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q6N8B2 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |