Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 449601..450254 | Replicon | chromosome |
Accession | NZ_CP113080 | ||
Organism | Acinetobacter baumannii strain AB5075-T |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B0V6V2 |
Locus tag | OSV62_RS02180 | Protein ID | WP_000931890.1 |
Coordinates | 449865..450254 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | OSV62_RS02175 | Protein ID | WP_001288210.1 |
Coordinates | 449601..449858 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSV62_RS02155 (OSV62_02155) | 445117..446124 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
OSV62_RS02160 (OSV62_02160) | 446143..446520 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
OSV62_RS02165 (OSV62_02165) | 446701..448191 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OSV62_RS02170 (OSV62_02170) | 448241..449413 | - | 1173 | WP_001190546.1 | acyl-CoA dehydrogenase family protein | - |
OSV62_RS02175 (OSV62_02175) | 449601..449858 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OSV62_RS02180 (OSV62_02180) | 449865..450254 | + | 390 | WP_000931890.1 | membrane protein | Toxin |
OSV62_RS02185 (OSV62_02185) | 451024..452109 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
OSV62_RS02190 (OSV62_02190) | 452187..452753 | + | 567 | WP_000651536.1 | rhombosortase | - |
OSV62_RS02195 (OSV62_02195) | 452941..455136 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.98 Da Isoelectric Point: 10.4623
>T265367 WP_000931890.1 NZ_CP113080:449865-450254 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1A4U0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BQM7 |