Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 470607..471260 | Replicon | chromosome |
| Accession | NZ_CP113077 | ||
| Organism | Acinetobacter baumannii strain 86II/2C | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OSV60_RS02295 | Protein ID | WP_025469989.1 |
| Coordinates | 470871..471260 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | OSV60_RS02290 | Protein ID | WP_001288210.1 |
| Coordinates | 470607..470864 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSV60_RS02270 (OSV60_02270) | 466122..467129 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| OSV60_RS02275 (OSV60_02275) | 467148..467525 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| OSV60_RS02280 (OSV60_02280) | 467707..469197 | + | 1491 | WP_000415127.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OSV60_RS02285 (OSV60_02285) | 469247..470419 | - | 1173 | WP_004839681.1 | acyl-CoA dehydrogenase family protein | - |
| OSV60_RS02290 (OSV60_02290) | 470607..470864 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OSV60_RS02295 (OSV60_02295) | 470871..471260 | + | 390 | WP_025469989.1 | membrane protein | Toxin |
| OSV60_RS02300 (OSV60_02300) | 472030..473115 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| OSV60_RS02305 (OSV60_02305) | 473193..473759 | + | 567 | WP_000651536.1 | rhombosortase | - |
| OSV60_RS02310 (OSV60_02310) | 473947..476142 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15603.93 Da Isoelectric Point: 10.3513
>T265364 WP_025469989.1 NZ_CP113077:470871-471260 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLVQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLVQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|