Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 449971..450624 | Replicon | chromosome |
Accession | NZ_CP113072 | ||
Organism | Acinetobacter baumannii strain A118 DeltaH0N27_10820-30::kan |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OSH16_RS02165 | Protein ID | WP_168726711.1 |
Coordinates | 450235..450624 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | OSH16_RS02160 | Protein ID | WP_001288210.1 |
Coordinates | 449971..450228 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSH16_RS02140 (OSH16_02140) | 445486..446493 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
OSH16_RS02145 (OSH16_02145) | 446512..446889 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
OSH16_RS02150 (OSH16_02150) | 447071..448561 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OSH16_RS02155 (OSH16_02155) | 448611..449783 | - | 1173 | WP_032061191.1 | acyl-CoA dehydrogenase family protein | - |
OSH16_RS02160 (OSH16_02160) | 449971..450228 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OSH16_RS02165 (OSH16_02165) | 450235..450624 | + | 390 | WP_168726711.1 | hypothetical protein | Toxin |
OSH16_RS02170 (OSH16_02170) | 451394..452479 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
OSH16_RS02175 (OSH16_02175) | 452557..453123 | + | 567 | WP_000651536.1 | rhombosortase | - |
OSH16_RS02180 (OSH16_02180) | 453311..455506 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15736.07 Da Isoelectric Point: 10.3599
>T265356 WP_168726711.1 NZ_CP113072:450235-450624 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEDHKTLTSIIWFDQMSLVEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEDHKTLTSIIWFDQMSLVEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|