Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3300976..3301629 | Replicon | chromosome |
| Accession | NZ_CP113071 | ||
| Organism | Acinetobacter baumannii strain A118 DeltaH0N27_10830::kan | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OSH14_RS15415 | Protein ID | WP_168726711.1 |
| Coordinates | 3300976..3301365 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | OSH14_RS15420 | Protein ID | WP_001288210.1 |
| Coordinates | 3301372..3301629 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSH14_RS15400 (OSH14_15400) | 3296094..3298289 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
| OSH14_RS15405 (OSH14_15405) | 3298477..3299043 | - | 567 | WP_000651536.1 | rhombosortase | - |
| OSH14_RS15410 (OSH14_15410) | 3299121..3300206 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| OSH14_RS15415 (OSH14_15415) | 3300976..3301365 | - | 390 | WP_168726711.1 | hypothetical protein | Toxin |
| OSH14_RS15420 (OSH14_15420) | 3301372..3301629 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OSH14_RS15425 (OSH14_15425) | 3301817..3302989 | + | 1173 | WP_032061191.1 | acyl-CoA dehydrogenase family protein | - |
| OSH14_RS15430 (OSH14_15430) | 3303039..3304529 | - | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OSH14_RS15435 (OSH14_15435) | 3304711..3305088 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| OSH14_RS15440 (OSH14_15440) | 3305107..3306114 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15736.07 Da Isoelectric Point: 10.3599
>T265355 WP_168726711.1 NZ_CP113071:c3301365-3300976 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEDHKTLTSIIWFDQMSLVEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEDHKTLTSIIWFDQMSLVEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|