Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 443338..443991 | Replicon | chromosome |
| Accession | NZ_CP113069 | ||
| Organism | Acinetobacter baumannii strain 29D2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OSV61_RS02160 | Protein ID | WP_065718990.1 |
| Coordinates | 443602..443991 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | OSV61_RS02155 | Protein ID | WP_001288210.1 |
| Coordinates | 443338..443595 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSV61_RS02135 (OSV61_02135) | 438853..439860 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| OSV61_RS02140 (OSV61_02140) | 439879..440256 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| OSV61_RS02145 (OSV61_02145) | 440438..441928 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OSV61_RS02150 (OSV61_02150) | 441978..443150 | - | 1173 | WP_065718991.1 | acyl-CoA dehydrogenase family protein | - |
| OSV61_RS02155 (OSV61_02155) | 443338..443595 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OSV61_RS02160 (OSV61_02160) | 443602..443991 | + | 390 | WP_065718990.1 | hypothetical protein | Toxin |
| OSV61_RS02165 (OSV61_02165) | 444761..445846 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| OSV61_RS02170 (OSV61_02170) | 445924..446490 | + | 567 | WP_000651536.1 | rhombosortase | - |
| OSV61_RS02175 (OSV61_02175) | 446678..448873 | + | 2196 | WP_065718989.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15637.93 Da Isoelectric Point: 10.4623
>T265351 WP_065718990.1 NZ_CP113069:443602-443991 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKITDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKITDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|