Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1823356..1823833 Replicon chromosome
Accession NZ_CP113052
Organism Staphylococcus aureus strain Fizz

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS084_RS09285 Protein ID WP_000052078.1
Coordinates 1823356..1823544 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS084_RS09290 Protein ID WP_001059690.1
Coordinates 1823573..1823833 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS084_RS09255 (1819397) 1819397..1819867 + 471 WP_000824472.1 hypothetical protein -
OS084_RS09260 (1820208) 1820208..1820894 + 687 WP_001548082.1 thermonuclease family protein -
OS084_RS09265 (1821251) 1821251..1821451 + 201 WP_001059082.1 cold-shock protein -
OS084_RS09270 (1821947) 1821947..1822165 - 219 WP_000005886.1 hypothetical protein -
OS084_RS09275 (1822227) 1822227..1822511 - 285 WP_001004395.1 hypothetical protein -
OS084_RS09280 (1822599) 1822599..1823168 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS084_RS09285 (1823356) 1823356..1823544 - 189 WP_000052078.1 hypothetical protein Toxin
OS084_RS09290 (1823573) 1823573..1823833 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS084_RS09295 (1824174) 1824174..1824377 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS084_RS09300 (1824374) 1824374..1824610 - 237 WP_000368687.1 hypothetical protein -
OS084_RS09305 (1824835) 1824835..1825416 + 582 WP_001140686.1 histidine phosphatase family protein -
OS084_RS09310 (1825489) 1825489..1826106 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS084_RS09315 (1826261) 1826261..1826755 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS084_RS09320 (1827154) 1827154..1827576 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS084_RS09325 (1827724) 1827724..1828440 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265349 WP_000052078.1 NZ_CP113052:c1823544-1823356 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265349 WP_001059690.1 NZ_CP113052:c1823833-1823573 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References