Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 251270..251799 | Replicon | chromosome |
Accession | NZ_CP113052 | ||
Organism | Staphylococcus aureus strain Fizz |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OS084_RS01550 | Protein ID | WP_000621175.1 |
Coordinates | 251270..251632 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OS084_RS01555 | Protein ID | WP_000948331.1 |
Coordinates | 251629..251799 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS084_RS01530 (248248) | 248248..249018 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
OS084_RS01535 (248993) | 248993..249472 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
OS084_RS01540 (249474) | 249474..249800 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OS084_RS01545 (249919) | 249919..250920 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
OS084_RS01550 (251270) | 251270..251632 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OS084_RS01555 (251629) | 251629..251799 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OS084_RS01560 (251884) | 251884..253032 | - | 1149 | WP_001281145.1 | alanine racemase | - |
OS084_RS01565 (253098) | 253098..253457 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
OS084_RS01570 (253461) | 253461..253952 | - | 492 | WP_267838006.1 | PH domain-containing protein | - |
OS084_RS01575 (253939) | 253939..255522 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
OS084_RS01580 (255515) | 255515..255994 | - | 480 | WP_001287088.1 | hypothetical protein | - |
OS084_RS01585 (256202) | 256202..256762 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265343 WP_000621175.1 NZ_CP113052:c251632-251270 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|